| Clone Name | rbaal13o15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | G6PI_CAMJE (Q9PMD4) Probable glucose-6-phosphate isomerase (EC 5... | 29 | 2.9 | 2 | UBE3C_MOUSE (Q80U95) Ubiquitin-protein ligase E3C (EC 6.3.2.-) | 29 | 3.8 |
|---|
>G6PI_CAMJE (Q9PMD4) Probable glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 406 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -2 Query: 207 SLCNKI---ELISYYLPSCMHAWISPDTPICLCSNELLDAWFAPVIM 76 SL NK+ EL++ + MHA I+ + + + E LDAW A +M Sbjct: 323 SLSNKVNLHELLNAQCDATMHALIAENLSVDVIELEKLDAWHAGYLM 369
>UBE3C_MOUSE (Q80U95) Ubiquitin-protein ligase E3C (EC 6.3.2.-)| Length = 1083 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 42 YLTVQKGSNSKTLLLEQTMHRAIHSSTNKSVYLAIS 149 YL V + S+ ++EQ +H +HS +S+YL I+ Sbjct: 181 YLPVLQDSSYVVSVIEQILHYMVHSGYYRSLYLLIN 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,312,895 Number of Sequences: 219361 Number of extensions: 537982 Number of successful extensions: 1427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)