| Clone Name | rbaal14d13 |
|---|---|
| Clone Library Name | barley_pub |
>IF5A2_ARATH (Q93VP3) Eukaryotic translation initiation factor 5A-2 (eIF-5A-2)| Length = 159 Score = 30.4 bits (67), Expect = 1.3 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 200 EQICAVKEIGGGK 162 EQICAVKE+GGGK Sbjct: 147 EQICAVKEVGGGK 159
>VEGFC_RAT (O35757) Vascular endothelial growth factor C precursor (VEGF-C)| (Vascular endothelial growth factor-related protein) (VRP) (Flt4 ligand) (Flt4-L) Length = 415 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 10/49 (20%) Frame = +1 Query: 82 CLCMCISNTQK--------H*XPSITARQPCT--AAYLPPPISFTAQIC 198 C C C NTQK H R+PCT + P +SF+ ++C Sbjct: 354 CACECTENTQKCFLKGKKFHHQTCSCYRRPCTNRLKHCDPGLSFSEEVC 402
>LEPA_PELUB (Q4FNH3) GTP-binding protein lepA| Length = 602 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +2 Query: 47 WIK--LVSPNRYLDAYVCVSQTPRSTXYQVSQLGNHAPL 157 WIK +++P++YL A + V Q R +S GN A L Sbjct: 406 WIKATIITPDQYLGAIIKVCQDKRGVQTNLSYSGNRAVL 444
>GSPL_XANCP (P34027) General secretion pathway protein L| Length = 373 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 174 RWWQVSSGAWLPSCDTWXLVL 112 RWWQ S AWLP W L L Sbjct: 24 RWWQQSLLAWLPQRWQWQLGL 44
>DPB11_YEAST (P47027) DNA replication regulator DPB11| Length = 764 Score = 27.7 bits (60), Expect = 8.3 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 7/68 (10%) Frame = +2 Query: 23 FGVKNTQIWIKLVSPNRYLDA-YVCVSQTPRSTXYQVSQLGNHAPLL------TCHHRFP 181 F K +IW K +S ++ + + Q+P S + L +++ L+ HH FP Sbjct: 280 FKPKGEKIWDKAMSLQQHSKTNFSVLGQSPLSINNKQEDLSDNSTLIFKNCAFIIHHIFP 339 Query: 182 SQRRSVLS 205 RS+L+ Sbjct: 340 GNHRSILT 347
>MPRI_BOVIN (P08169) Cation-independent mannose-6-phosphate receptor precursor| (CI Man-6-P receptor) (CI-MPR) (M6PR) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (300 kDa mannose 6-phosphate receptor) Length = 2499 Score = 27.7 bits (60), Expect = 8.3 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = +2 Query: 17 RAFGVKNTQIWIKLVSPNRYLDAYVCVSQTPRSTXYQVSQLGNHAPLLTCHHRFPSQRRS 196 RAF V Q +KLVS +R + +YV + Q H+P +T PS+RR Sbjct: 247 RAFDVGRPQEGLKLVSNDRLVLSYV------KEGAGQPDFCDGHSPAVTITFVCPSERRE 300 Query: 197 VLSP 208 P Sbjct: 301 GTIP 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,756,728 Number of Sequences: 219361 Number of extensions: 594690 Number of successful extensions: 1470 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)