| Clone Name | rbaal14d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CCD72_XENTR (Q28GR1) Coiled-coil domain-containing protein 72 | 36 | 0.034 | 2 | CCD72_MOUSE (Q8K003) Coiled-coil domain-containing protein 72 | 33 | 0.29 | 3 | CCD72_HUMAN (Q9Y2S6) Coiled-coil domain-containing protein 72 | 33 | 0.29 | 4 | Y022_THEAC (Q9HM47) UPF0204 protein Ta0022 | 31 | 1.4 | 5 | COHA1_CHICK (Q90584) Collagen alpha-1(XVII) chain (Bullous pemph... | 28 | 7.1 |
|---|
>CCD72_XENTR (Q28GR1) Coiled-coil domain-containing protein 72| Length = 64 Score = 36.2 bits (82), Expect = 0.034 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = -3 Query: 349 KQGGKAKPLKQAKVAEKDYDENDLAY 272 ++GGK KPLKQ K + KD DE+++A+ Sbjct: 4 REGGKKKPLKQPKKSNKDMDEDEIAF 29
>CCD72_MOUSE (Q8K003) Coiled-coil domain-containing protein 72| Length = 64 Score = 33.1 bits (74), Expect = 0.29 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 349 KQGGKAKPLKQAKVAEKDYDENDLAY 272 ++GGK KPLKQ K K+ DE D A+ Sbjct: 4 REGGKKKPLKQPKKQAKEMDEEDKAF 29
>CCD72_HUMAN (Q9Y2S6) Coiled-coil domain-containing protein 72| Length = 64 Score = 33.1 bits (74), Expect = 0.29 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 349 KQGGKAKPLKQAKVAEKDYDENDLAY 272 ++GGK KPLKQ K K+ DE D A+ Sbjct: 4 REGGKKKPLKQPKKQAKEMDEEDKAF 29
>Y022_THEAC (Q9HM47) UPF0204 protein Ta0022| Length = 256 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 121 HRLSFSGHYEWAGRLISSHSSSDQI--LPAHPSGQPWPSAPSG 243 H +S SG Y++ ++S HSS+ + L AHP+G PSA G Sbjct: 50 HDMSLSGKYDYLV-VLSRHSSAADVKSLTAHPTGNFGPSADLG 91
>COHA1_CHICK (Q90584) Collagen alpha-1(XVII) chain (Bullous pemphigoid antigen| 2) (180 kDa bullous pemphigoid antigen 2) (Fragment) Length = 1146 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 157 GRLISSHSSSDQILPAHPSGQPWPSAPSGP 246 G++IS+ SS LP P G P P P+GP Sbjct: 389 GKVISAEGSSTIALPG-PPGPPGPIGPTGP 417 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,532,350 Number of Sequences: 219361 Number of extensions: 660623 Number of successful extensions: 2520 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2505 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)