| Clone Name | rbaal14d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NALP4_HUMAN (Q96MN2) NACHT-, LRR- and PYD-containing protein 4 (... | 32 | 0.76 | 2 | SYA_MYCPE (Q8EUR6) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 30 | 2.2 |
|---|
>NALP4_HUMAN (Q96MN2) NACHT-, LRR- and PYD-containing protein 4| (PYRIN-containing APAF1-like protein 4) (PAAD and NACHT-containing protein 2) (PYRIN and NACHT-containing protein 2) (Ribonuclease inhibitor 2) Length = 994 Score = 32.0 bits (71), Expect = 0.76 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 25 SYVHIHIVHLDVCRSFYFLGKGHYVHPHLAL 117 SYV +H+ + C + ++L K H HPH A+ Sbjct: 447 SYVFLHVCIQEFCAALFYLLKSHLDHPHPAV 477
>SYA_MYCPE (Q8EUR6) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 930 Score = 30.4 bits (67), Expect = 2.2 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +1 Query: 52 LDVCRSFYFLGKGHYVHPHLALLYRVLFVCPET*EGDLCIEQHLYN---VSSTAATSMPR 222 LD + +G V+ ++ RVL++CPE+ E +C H+YN + T + Sbjct: 664 LDEAKEMGAIGYFEQVYKKISGKLRVLYLCPESIE--ICGGTHVYNTGDIEDFMVTGLTS 721 Query: 223 TKSNSW 240 S SW Sbjct: 722 KGSGSW 727 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,168,718 Number of Sequences: 219361 Number of extensions: 1279202 Number of successful extensions: 3505 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3505 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)