| Clone Name | rbaal13n18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DRI_DROME (Q24573) Protein dead ringer (Protein retained) | 30 | 7.1 | 2 | UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Exci... | 30 | 9.3 |
|---|
>DRI_DROME (Q24573) Protein dead ringer (Protein retained)| Length = 911 Score = 30.0 bits (66), Expect = 7.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 12 ADKFYDTSNPLQLQGHKHIQQRHL*QLNKKGVWNQP 119 + +D S P Q+ GH H Q HL + + + N P Sbjct: 691 SSSMHDDSEPQQMNGHHHHQTHHLDKSDDSAIENSP 726
>UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 939 Score = 29.6 bits (65), Expect = 9.3 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -3 Query: 336 DVMILVSIVQPLLEEINAILV-KHQLDMLKC 247 DV LV I+Q L++ N ++V +H LDM+KC Sbjct: 866 DVNRLVKILQRLVDGGNTVIVIEHNLDMIKC 896 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,020,195 Number of Sequences: 219361 Number of extensions: 1766838 Number of successful extensions: 3608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3608 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)