ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal14c01 |
|---|---|
| Clone Library Name | barley_pub |
>TERM_ADECC (Q65947) DNA terminal protein (Bellett protein) (pTP protein)| Length = 608 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 109 FVFHQIAVFLLLPPSRPPRAHFLLLFPCPHLYKDMKIILNLC--YIFRQRNFVR*QQIKL 282 + +H++ + L P L L+P PHL + ++ C Y+F R++ R + ++ Sbjct: 53 YQYHRLMLMNLSPREPATEGWPLFLYPPPHLLVGYQYLVRTCNDYVFDTRSYSRLKYTEI 112 Query: 283 HI 288 H+ Sbjct: 113 HL 114
>TERM_ADECR (Q96682) DNA terminal protein (Bellett protein) (pTP protein)| Length = 723 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 109 FVFHQIAVFLLLPPSRPPRAHFLLLFPCPHLYKDMKIILNLC--YIFRQRNFVR*QQIKL 282 + +H++ + L P L L+P PHL + ++ C Y+F R++ R + ++ Sbjct: 168 YQYHRLMLMNLSPREPATEGWPLFLYPPPHLLVGYQYLVRTCNDYVFDTRSYSRLKYTEI 227 Query: 283 HI 288 H+ Sbjct: 228 HL 229
>F262_BOVIN (P26285) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2| (6PF-2-K/Fru-2,6-P2ASE heart-type isozyme) (PFK-2/FBPase-2) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 530 Score = 30.4 bits (67), Expect = 3.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = +3 Query: 297 SYFL*KA-----YLSCPFLSIYKQTPIQYICNKKT 386 +YFL K YL CP +I+K TP+ Y C +T Sbjct: 400 AYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVET 434
>F262_HUMAN (O60825) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2| (6PF-2-K/Fru-2,6-P2ASE heart-type isozyme) (PFK-2/FBPase-2) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 505 Score = 30.4 bits (67), Expect = 3.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = +3 Query: 297 SYFL*KA-----YLSCPFLSIYKQTPIQYICNKKT 386 +YFL K YL CP +I+K TP+ Y C +T Sbjct: 400 AYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVET 434
>TEGU_SHV21 (Q01056) Probable large tegument protein| Length = 2469 Score = 30.0 bits (66), Expect = 5.0 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = +3 Query: 57 SMCITYSMLFLHRAKHIFCFSPNSC--VPFAPX-XXXXXXXXXXXXXMSPPVQRHENYSK 227 ++C + SM L + K IF F P+SC VP +P +SPP + Y+ Sbjct: 143 AICNSKSMGILIKDKKIFIFDPHSCPLVPNSPAHVFSTSNVNDAIEYLSPP---NVQYTG 199 Query: 228 SVLYISAKKF 257 S LY K++ Sbjct: 200 SFLYFVPKEY 209
>F262_MOUSE (P70265) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2| (6PF-2-K/Fru-2,6-P2ASE heart-type isozyme) (PFK-2/FBPase-2) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 519 Score = 29.3 bits (64), Expect = 8.5 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Frame = +3 Query: 297 SYFL*KA-----YLSCPFLSIYKQTPIQYICNKKT 386 +YFL K YL CP I+K TP+ Y C +T Sbjct: 403 AYFLDKGADELPYLRCPLHIIFKLTPVAYGCKVET 437
>F262_RAT (Q9JJH5) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2| (6PF-2-K/Fru-2,6-P2ASE heart-type isozyme) (PFK-2/FBPase-2) (RH2K) [Includes: 6-phosphofructo-2-kinase (EC 2.7.1.105); Fructose-2,6-bisphosphatase (EC 3.1.3.46)] Length = 557 Score = 29.3 bits (64), Expect = 8.5 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Frame = +3 Query: 297 SYFL*KA-----YLSCPFLSIYKQTPIQYICNKKT 386 +YFL K YL CP I+K TP+ Y C +T Sbjct: 403 AYFLDKGADELPYLRCPLHIIFKLTPVAYGCKVET 437 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,658,489 Number of Sequences: 219361 Number of extensions: 1615719 Number of successful extensions: 3686 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3685 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
