| Clone Name | rbaal13m10 |
|---|---|
| Clone Library Name | barley_pub |
>SYP1_YEAST (P25623) Suppressor of yeast profilin deletion| Length = 870 Score = 31.6 bits (70), Expect = 1.8 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = -3 Query: 506 PSSASPTRSVRAYAKADEEEGEKKVP----KQSLFGNITEALDFSQVRSEKDAELLYEAR 339 P+SA+ R V A E EKK P ++S FGNI L + + + E Sbjct: 265 PASATGARPVSVSNGAANTEREKKSPQKDKRKSAFGNIGHRLASASSSLTHNDLMNNEFS 324 Query: 338 DSIKDEGRMTREQYAALRRKIGGTY 264 DS + +++ LR K+G + Sbjct: 325 DSTNNSSLKSKKSSHTLRSKVGSIF 349
>PSR1_YEAST (Q07800) Phosphatase PSR1 (EC 3.1.3.-) (Plasma membrane sodium| response protein 1) Length = 427 Score = 30.4 bits (67), Expect = 4.1 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = -3 Query: 509 KPSSASPTRSVRAYAKADEEEGEKKVPKQSLFGNITEALDFSQVRSE---KDAELLYEAR 339 K +SPT +V A + + EK++ K L+ E + ++ E + ++ E Sbjct: 84 KKKPSSPTAAVTATTTNNMTKVEKRISKDDLYEEKYEVDEDEEIDDEDNRRSRGIVQEKG 143 Query: 338 DSIKDEGRMTREQ 300 D++KD R ++Q Sbjct: 144 DAVKDTSRQKKQQ 156
>ZCHC6_MOUSE (Q5BLK4) Zinc finger CCHC domain-containing protein 6| Length = 1491 Score = 29.6 bits (65), Expect = 6.9 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 7/90 (7%) Frame = -3 Query: 515 CFKPSSASPTRSVRAYAKADEEEGEKKVPKQSLFGNITEALDFSQVRSEKDAELLYEA-- 342 CF PS S T + + +EEE E++ + L N+TE D V +E + Y Sbjct: 828 CFSPSVQSRTSAAMHFDDEEEEEEEEEEEEPRLSINLTE--DEEGVANEHQVDSRYAGSG 885 Query: 341 -RDSIKDEGRMTR----EQYAALRRKIGGT 267 D++ +E + E +GGT Sbjct: 886 EEDALSEEDDLAEPAKGEDTGECGENVGGT 915
>TAGAP_MOUSE (Q8K2L9) T-cell activation Rho GTPase-activating protein (T-cell| activation GTPase-activating protein) Length = 714 Score = 29.3 bits (64), Expect = 9.1 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 7/110 (6%) Frame = -3 Query: 572 ALALSPTQSSS------FGLHQSTPCFKPSSASPTRSVRAYAKADEEEGEKKV-PKQSLF 414 +L SP S S F HQS K P R +R ++ + KKV P+ S Sbjct: 466 SLGSSPVPSPSCPKRNFFTRHQSFTT-KTDKTKPQREIRKHSMSFSFASHKKVLPRTSSI 524 Query: 413 GNITEALDFSQVRSEKDAELLYEARDSIKDEGRMTREQYAALRRKIGGTY 264 G+ ++ DFS+ + +KD + I E + +L + GT+ Sbjct: 525 GS-EKSKDFSRDQLQKDLRKESQLSGRIVQENESEIQSQTSLGFSLSGTW 573
>RM02_RECAM (O21247) Mitochondrial 60S ribosomal protein L2| Length = 277 Score = 29.3 bits (64), Expect = 9.1 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 8/62 (12%) Frame = -3 Query: 593 GKAMAMRALALSPTQ--------SSSFGLHQSTPCFKPSSASPTRSVRAYAKADEEEGEK 438 G+ +R +A++P +S G TP P+ PTRS R Y K + +K Sbjct: 216 GRRPIVRGVAMNPVDHPHGGGEGKTSGGRPSVTPWSWPTKGQPTRSKRKYNKLIVQRAKK 275 Query: 437 KV 432 K+ Sbjct: 276 KI 277
>CALCA_CHICK (P10286) Calcitonin gene-related peptide precursor (CGRP)| Length = 125 Score = 29.3 bits (64), Expect = 9.1 Identities = 28/90 (31%), Positives = 33/90 (36%) Frame = -3 Query: 338 DSIKDEGRMTREQYAALRRKIGGTYKDFFKSXXXXXXXXXXXXXXDKTCKVCKKDTRGEP 159 +SI D R+T Y A RR + KDF + + C T Sbjct: 33 ESITD--RVTLSDYEA-RRLLNALVKDFIQMTAEELEQASEGNSVTAQKRACNTATCVTH 89 Query: 158 RQVDNLGRYMHVACAENSKPTNFFSKLFGR 69 R D L R V N PTN SK FGR Sbjct: 90 RLADFLSRSGGVG-KNNFVPTNVGSKAFGR 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,859,218 Number of Sequences: 219361 Number of extensions: 1678836 Number of successful extensions: 6466 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6438 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)