| Clone Name | rbaal14b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DPOLQ_HUMAN (O75417) DNA polymerase theta (EC 2.7.7.7) (DNA poly... | 31 | 3.5 | 2 | ISPZ_BUCAI (P57363) Probable intracellular septation protein | 30 | 7.9 |
|---|
>DPOLQ_HUMAN (O75417) DNA polymerase theta (EC 2.7.7.7) (DNA polymerase eta)| Length = 1762 Score = 30.8 bits (68), Expect = 3.5 Identities = 24/79 (30%), Positives = 37/79 (46%) Frame = +3 Query: 327 KSRNHHLK*S*YDILESICQLTVMFALDTSRTKIIQKILNSNARNVRCWFWKNNNLQPDL 506 K++N+H+ D+ +C F LDT KIIQ++ NA+ K+ NL + Sbjct: 474 KTKNNHVS----DLGLVLCDFEDSFYLDTQSEKIIQQMATENAKLGA----KDTNLAAGI 525 Query: 507 KQNSKVML*PNPNQNAFNK 563 Q S V + N+F K Sbjct: 526 MQKSLVQ---QNSMNSFQK 541
>ISPZ_BUCAI (P57363) Probable intracellular septation protein| Length = 177 Score = 29.6 bits (65), Expect = 7.9 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -1 Query: 516 CSVLNLVASYYFSRT---NILHFGHWNLGFFV 430 C++LN+ +YYFS T N FG +L FF+ Sbjct: 130 CAILNIYIAYYFSETIWVNFKVFGFTSLTFFL 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,922,405 Number of Sequences: 219361 Number of extensions: 1273395 Number of successful extensions: 2467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2466 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)