| Clone Name | rbaal13l22 |
|---|---|
| Clone Library Name | barley_pub |
>INV1_MAIZE (P49175) Beta-fructofuranosidase 1 precursor (EC 3.2.1.26) (Sucrose| 1) (Invertase 1) Length = 670 Score = 42.0 bits (97), Expect = 5e-04 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTTSXVIHXMDSSNNQAYTAS 13 VYPT AIY +A V+LFNNAT A V S I ++S+ + Y A+ Sbjct: 622 VYPTRAIYDSARVFLFNNATHAHVKAKSVKIWQLNSAYIRPYPAT 666
>INVB_DAUCA (P80065) Beta-fructofuranosidase, soluble isoenzyme I precursor (EC| 3.2.1.26) (Sucrose hydrolase) (Invertase) (Saccharase) Length = 661 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTT 67 VYPT AIY+ A V+LFNNATG VT + Sbjct: 616 VYPTRAIYSAARVFLFNNATGVSVTAS 642
>INVA_LYCES (P29000) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 636 Score = 39.3 bits (90), Expect = 0.003 Identities = 19/42 (45%), Positives = 30/42 (71%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTTSXVIHXMDSSNNQAY 22 +YPT+A+ A +++FNNATGA V T S I ++S+N Q++ Sbjct: 591 IYPTKAVNGAARLFVFNNATGASV-TASVKIWSLESANIQSF 631
>INVA_PHAAU (P29001) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) [Contains: Acid beta-fructofuranosidase 30 kDa subunit; Acid beta-fructofuranosidase 38 kDa subunit] Length = 649 Score = 37.7 bits (86), Expect = 0.009 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTTSXV 58 VYPT+AIY A ++LFNNAT A VT + V Sbjct: 601 VYPTKAIYGAARLFLFNNATEATVTASLKV 630
>INVA_PHAVU (O24509) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 651 Score = 37.4 bits (85), Expect = 0.011 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTT 67 VYPT+AIY A ++LFNNAT A VT + Sbjct: 603 VYPTKAIYGAARLFLFNNATEATVTAS 629
>INV1_CAPAN (P93761) Acid beta-fructofuranosidase AIV-18 (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) Length = 640 Score = 35.8 bits (81), Expect = 0.033 Identities = 16/42 (38%), Positives = 30/42 (71%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTTSXVIHXMDSSNNQAY 22 +YPT+A+ A +++FNNATGA + T S I ++S++ +++ Sbjct: 595 IYPTKAVNGAARLFVFNNATGA-IVTASLKIWSLESADIRSF 635
>INVA_VICFA (Q43857) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 642 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGARVTTTSXV 58 VYPT AIY A ++LFNNA VT + V Sbjct: 593 VYPTRAIYGAARLFLFNNAIETNVTASLKV 622
>INV3_DAUCA (Q39693) Beta-fructofuranosidase, insoluble isoenzyme 3 precursor| (EC 3.2.1.26) (Sucrose hydrolase 3) (Invertase 3) (Cell wall beta-fructosidase 3) Length = 583 Score = 31.2 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNAT 88 VYPT AIY NA +++FNN T Sbjct: 544 VYPTLAIYNNAHLFVFNNGT 563
>INV1_DAUCA (P26792) Beta-fructofuranosidase, insoluble isoenzyme 1 precursor| (EC 3.2.1.26) (Sucrose hydrolase 1) (Invertase 1) (Cell wall beta-fructosidase 1) Length = 592 Score = 31.2 bits (69), Expect = 0.80 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNAT 88 VYPT A+Y NA +Y+FNN + Sbjct: 553 VYPTLAVYENAHLYVFNNGS 572
>INV2_DAUCA (Q39692) Beta-fructofuranosidase, insoluble isoenzyme 2 precursor| (EC 3.2.1.26) (Sucrose hydrolase 2) (Invertase 2) (Cell wall beta-fructosidase 2) Length = 592 Score = 30.8 bits (68), Expect = 1.1 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 147 VYPTEAIYANAGVYLFNNATGA 82 VYP AIY NA V++FNN T A Sbjct: 551 VYPKIAIYNNAHVFVFNNGTEA 572 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.146 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,480,455 Number of Sequences: 219361 Number of extensions: 133076 Number of successful extensions: 286 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)