ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal13k18 |
|---|---|
| Clone Library Name | barley_pub |
>ZN706_MOUSE (Q9D115) Zinc finger protein 706| Length = 76 Score = 47.8 bits (112), Expect = 2e-05 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 4/68 (5%) Frame = -2 Query: 435 MTRGKQKIDAQRKSAEKN---QKSKGSQLEARA-VGLKVVCPICKAQLANEKQLIDHYGS 268 M RG+QKI +Q+K+A+K +K +G +A A L C +C+ Q+ + K H+ S Sbjct: 1 MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFES 60 Query: 267 KHPREKPP 244 KHP+ P Sbjct: 61 KHPKTPLP 68
>ZN706_HUMAN (Q9Y5V0) Zinc finger protein 706| Length = 76 Score = 47.8 bits (112), Expect = 2e-05 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 4/68 (5%) Frame = -2 Query: 435 MTRGKQKIDAQRKSAEKN---QKSKGSQLEARA-VGLKVVCPICKAQLANEKQLIDHYGS 268 M RG+QKI +Q+K+A+K +K +G +A A L C +C+ Q+ + K H+ S Sbjct: 1 MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFES 60 Query: 267 KHPREKPP 244 KHP+ P Sbjct: 61 KHPKTPLP 68
>ZN706_CHICK (Q5ZMM5) Zinc finger protein 706| Length = 76 Score = 47.8 bits (112), Expect = 2e-05 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 4/68 (5%) Frame = -2 Query: 435 MTRGKQKIDAQRKSAEKNQKSKGSQ----LEARAVGLKVVCPICKAQLANEKQLIDHYGS 268 M RG+QKI +Q+K+A+K + K Q A L C +C+ Q+ + K H+ S Sbjct: 1 MARGQQKIQSQQKNAKKQAEQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFES 60 Query: 267 KHPREKPP 244 KHP+ P Sbjct: 61 KHPKTPLP 68
>HANG_DROME (Q9VXG1) Zinc finger protein hangover| Length = 1959 Score = 35.4 bits (80), Expect = 0.082 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = -2 Query: 408 AQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHPREKP 247 A + SA ++ + SQ +R + VCPIC Q N ++ H SKHP + P Sbjct: 748 AAQSSANRDASAPKSQYFSR---MPQVCPICGQQYNNYNNVLRHMESKHPNKLP 798
>AKP8L_MOUSE (Q9R0L7) A-kinase anchor protein 8-like (AKAP8-like protein)| (Neighbor of A-kinase-anchoring protein 95) (Neighbor of AKAP95) Length = 642 Score = 34.7 bits (78), Expect = 0.14 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = -2 Query: 432 TRGKQKIDAQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHPRE 253 ++ K+K+ A +KS +K +K + ++ R ++ VC +CK + E ++ H SK +E Sbjct: 360 SQAKRKLQASKKSQDKQKKRQRDRMVER---IQFVCSLCKYRTFYEDEMGSHLDSKFHKE 416
>AKP8L_HUMAN (Q9ULX6) A-kinase anchor protein 8-like (AKAP8-like protein)| (Neighbor of A-kinase anchoring protein 95) (Neighbor of AKAP95) (Homologous to AKAP95 protein) (HA95) (Helicase A-binding protein 95) (HAP95) Length = 646 Score = 34.3 bits (77), Expect = 0.18 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = -2 Query: 423 KQKIDAQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHPRE 253 K+K+ A +KS +K +K + ++ R ++ VC +CK + E ++ H SK +E Sbjct: 362 KRKLQAGKKSQDKQKKRQRDRMVER---IQFVCSLCKYRTFYEDEMASHLDSKFHKE 415
>LUC7L_MOUSE (Q9CYI4) Putative RNA-binding protein Luc7-like 1| Length = 371 Score = 32.3 bits (72), Expect = 0.70 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -2 Query: 420 QKIDAQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLA---NEKQLIDHYGSK 265 +K+ A++K AE+ ++ + L+V C +C A L N+++L DH+G K Sbjct: 160 EKVRAKKKEAEEEYRNSMPASSFQQQKLRV-CEVCSAYLGLHDNDRRLADHFGGK 213
>LUC7L_HUMAN (Q9NQ29) Putative RNA-binding protein Luc7-like 1 (SR+89) (Putative| SR protein LUC7B1) Length = 371 Score = 32.3 bits (72), Expect = 0.70 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -2 Query: 420 QKIDAQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLA---NEKQLIDHYGSK 265 +K+ A++K AE+ ++ + L+V C +C A L N+++L DH+G K Sbjct: 160 EKVRAKKKEAEEEYRNSMPASSFQQQKLRV-CEVCSAYLGLHDNDRRLADHFGGK 213
>ZN462_HUMAN (Q96JM2) Zinc finger protein 462| Length = 1412 Score = 30.8 bits (68), Expect = 2.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 327 CPICKAQLANEKQLIDHYGSKHPREK 250 C +C+++ N L+ HYG KHP K Sbjct: 317 CTVCQSEYNNLHGLLTHYGKKHPGMK 342
>APLP_DROME (Q9V496) Apolipophorins precursor (Retinoid- and fatty acid-binding| glycoprotein) [Contains: Apolipophorin-2 (Apolipophorin II) (ApoL2); Apolipophorin-1 (Apolipophorin I) (ApoL1)] Length = 3351 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 372 KGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGS 268 KG+ + + G+K C C Q+ EK+++D Y S Sbjct: 3124 KGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNS 3158
>TILS_RICCN (Q92JK0) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 478 Score = 30.4 bits (67), Expect = 2.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 32 LMVCRQFDKILIEGKYMLIKALAWNKRKCI 121 L++ R+F K L E K +L K++ W+ R CI Sbjct: 362 LLIYREFGKKLPESKILLDKSVIWDNRFCI 391
>YKKA_CAEEL (Q95QY7) Putative zinc finger protein C02F5.12| Length = 380 Score = 30.4 bits (67), Expect = 2.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 336 KVVCPICKAQLANEKQLIDHYGSKHPREKPPG 241 K+ C +C + N +++ HY HP E+ G Sbjct: 270 KIPCKLCGFECTNVRRMRSHYAKAHPNERVEG 301
>GRDA2_EUBAC (O32518) Glycine/sarcosine/betaine reductase complex component A2| (EC 1.21.4.2) (EC 1.21.4.3) (EC 1.21.4.4) (Selenoprotein PA 2) (Thioredoxin reductase complex selenoprotein A 2) Length = 158 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = -2 Query: 258 REKPPGPSNAE*LMGSGS---MSYTDCF*GCSVCSTLGRLELQ 139 R+ PGP+ AE L G+G+ S T+CF VC+ G ++L+ Sbjct: 15 RDGIPGPAMAECLKGTGAEVVYSATECF----VCTAAGAMDLE 53
>PEP7_SCHPO (O13786) Vacuolar segregation protein pep7| Length = 536 Score = 29.3 bits (64), Expect = 5.9 Identities = 18/62 (29%), Positives = 25/62 (40%), Gaps = 4/62 (6%) Frame = -2 Query: 435 MTRGKQKIDAQRKSAEKNQKSKGSQLEARAVGLKVV----CPICKAQLANEKQLIDHYGS 268 M GK++I + S N A++ +V CPIC +L N L DH Sbjct: 1 MQNGKRRIGVRISSNLSNHSGTNLSTSAQSDSSNIVKATECPICGLELPNLSALNDHLDV 60 Query: 267 KH 262 H Sbjct: 61 TH 62
>RN125_MACFA (Q95KF1) RING finger protein 125 (EC 6.3.2.-)| Length = 231 Score = 29.3 bits (64), Expect = 5.9 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = -2 Query: 408 AQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHPREKPP 244 A ++ +K G E + VCP C+ +L +E L+DH + H E+ P Sbjct: 113 AHIRTCQKYIDKYGPLQELGETAARCVCPFCQREL-DEDSLLDHCITHHRSERRP 166
>RN125_MOUSE (Q9D9R0) RING finger protein 125 (EC 6.3.2.-)| Length = 232 Score = 29.3 bits (64), Expect = 5.9 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = -2 Query: 408 AQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHPREKPP 244 A ++ EK G LE + VCP C+ +L +E L+DH H E+ P Sbjct: 114 AHIRTCEKYIDKYGPLLELGDTTARCVCPFCQREL-DEDCLLDHCIIHHRSERRP 167
>YANB_SCHPO (Q10076) Hypothetical zinc finger protein C3H1.11 in chromosome I| Length = 582 Score = 29.3 bits (64), Expect = 5.9 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 411 DAQRKSAEKNQKSKGSQLEARAVGLK-VVCPICKAQLANEKQLIDHYGSKHPREKP 247 D K ++ Q S R+ G K VCP C + + L H S H EKP Sbjct: 396 DGSMKRRKRRQPSNRKTSVPRSPGGKSFVCPECSKKFKRSEHLRRHIRSLHTSEKP 451
>PRD10_HUMAN (Q9NQV6) PR domain zinc finger protein 10 (PR domain-containing| protein 10) Length = 1061 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 375 SKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHP 259 S +QL V CP C Q +++ +++ H KHP Sbjct: 734 STHTQLTGTIATPPVCCPHCSKQYSSKTKMVQHIRKKHP 772
>RGS3_HUMAN (P49796) Regulator of G-protein signaling 3 (RGS3) (RGP3)| Length = 1198 Score = 28.9 bits (63), Expect = 7.7 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 150 VVQVWSRLSSLRNSPYSSCFRFPSVTLHLMDLEVSPWGALI 272 +V VW+R S R S C F +L D E+S W L+ Sbjct: 219 LVTVWNRASQSRQSGLIGCMSFGVKSLLTPDKEISGWYYLL 259
>RN125_HUMAN (Q96EQ8) RING finger protein 125 (EC 6.3.2.-) (T-cell RING| activation protein 1) (TRAC-1) Length = 231 Score = 28.9 bits (63), Expect = 7.7 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = -2 Query: 408 AQRKSAEKNQKSKGSQLEARAVGLKVVCPICKAQLANEKQLIDHYGSKHPREKPP 244 A ++ +K G E + VCP C+ +L E L+DH + H E+ P Sbjct: 113 AHIRTCQKYIDKYGPLQELEETAARCVCPFCQREL-YEDSLLDHCITHHRSERRP 166
>TILS_RICTY (Q68XR8) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 430 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 32 LMVCRQFDKILIEGKYMLIKALAWNKRKCI 121 L++ R+F K L + K +L K++ W+ R CI Sbjct: 314 LLIYREFGKKLPKSKILLDKSVIWDNRFCI 343
>TILS_RICPR (Q9ZEA3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 430 Score = 28.9 bits (63), Expect = 7.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 32 LMVCRQFDKILIEGKYMLIKALAWNKRKCI 121 L++ R+F K L + K +L K++ W+ R CI Sbjct: 314 LLIYREFGKKLPKSKILLDKSVIWDNRFCI 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,076,388 Number of Sequences: 219361 Number of extensions: 980811 Number of successful extensions: 3035 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3032 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
