| Clone Name | rbaal13j15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1993_PSEAE (Q9I2B6) UPF0226 protein PA1993 | 29 | 3.2 | 2 | DPOG2_HUMAN (Q9UHN1) DNA polymerase gamma subunit 2, mitochondri... | 29 | 3.2 | 3 | NING_BPH19 (O48427) Protein ninG | 29 | 3.2 | 4 | SPP1_YEAST (Q03012) COMPASS component SPP1 (Complex proteins ass... | 29 | 3.2 | 5 | SPP1_SCHPO (O74508) Set1 complex component spp1 (Set1C component... | 29 | 3.2 | 6 | Y481_TREPA (O83494) Hypothetical protein TP0481 | 28 | 4.2 | 7 | Y1684_METTH (O27719) Hypothetical protein MTH1684 | 27 | 9.4 | 8 | YBL2_SFV1 (P29170) BEL-2 protein | 27 | 9.4 |
|---|
>Y1993_PSEAE (Q9I2B6) UPF0226 protein PA1993| Length = 402 Score = 28.9 bits (63), Expect = 3.2 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -1 Query: 142 GAVVVK-LNYWSAPFC*VAFSVLGFALSLPQL---LVHGRVRPF 23 G ++V+ L WS V LGFAL+ P+L LVHG PF Sbjct: 174 GVLLVQWLGLWSMGASIVLLGALGFALAWPKLPAPLVHGERLPF 217
>DPOG2_HUMAN (Q9UHN1) DNA polymerase gamma subunit 2, mitochondrial precursor| (EC 2.7.7.7) (Mitochondrial DNA polymerase accessory subunit) (PolG-beta) (MtPolB) (DNA polymerase gamma accessory 55 kDa subunit) (p55) Length = 485 Score = 28.9 bits (63), Expect = 3.2 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 6/72 (8%) Frame = -3 Query: 206 GQXPDAPCR---KEEA*EVLIRGKWSSSCKTELLERSILLGCIFGF---GVCLEFATAAR 45 G+ P+AP E E+ R + S K +L S+L GC GF GV L AA Sbjct: 54 GEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAE 113 Query: 44 PWTCPSVPYQQI 9 WT V +Q+ Sbjct: 114 WWTSVVVFREQV 125
>NING_BPH19 (O48427) Protein ninG| Length = 201 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 71 KPQNRKCNLT-EWSAPIIQFYNYCSTSHGSK 160 KP RKC + EW P +CS HG+K Sbjct: 3 KPARRKCKICKEWFHPAFSNQWWCSPEHGTK 33
>SPP1_YEAST (Q03012) COMPASS component SPP1 (Complex proteins associated with| SET1 protein SPP1) (Set1C component SPP1) (Suppressor of PRP protein 1) Length = 353 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 38 SMDEQLWQTQGKPQNRKCNLTEWSAPIIQFYNYCSTSHG 154 S+ + LW+ RKC +++ P +Q YCS HG Sbjct: 87 SLPKTLWK-------RKCRISDCYKPCLQDSKYCSEEHG 118
>SPP1_SCHPO (O74508) Set1 complex component spp1 (Set1C component spp1)| (COMPASS component spp1) (Complex proteins associated with set1 protein spp1) Length = 424 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 83 RKCNLTEWSAPIIQFYNYCSTSHG 154 RKC L E S P NYCS HG Sbjct: 177 RKCRLRECSNPTRPNSNYCSDKHG 200
>Y481_TREPA (O83494) Hypothetical protein TP0481| Length = 477 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 207 PKCPSRGEGHAGNRSTSHGYRCTRH 281 PK PSR H G R T H + C R+ Sbjct: 7 PKTPSRRIRHTGRRRTLHRFFCKRY 31
>Y1684_METTH (O27719) Hypothetical protein MTH1684| Length = 431 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -3 Query: 131 CKTELLERSILLGCIFGFGVCLEFATAARPWTCPSVPYQ 15 C T ++ + L FG GVC W+CPS Y+ Sbjct: 357 CPTHAIDNGLDLDRCFGCGVC--------AWSCPSGAYE 387
>YBL2_SFV1 (P29170) BEL-2 protein| Length = 403 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 53 LWQTQGKPQNRKCNLTEWSAP 115 LWQ G P RKC +T++ P Sbjct: 92 LWQCLGDPSGRKCMVTQFLLP 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,871,443 Number of Sequences: 219361 Number of extensions: 984290 Number of successful extensions: 2451 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2451 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)