| Clone Name | rbaal13i17 |
|---|---|
| Clone Library Name | barley_pub |
>GLYN_FLAPR (P49358) Serine hydroxymethyltransferase 2, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 517 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 287 SNXQXEIAKLRHDVEEYAXQFPTIGFEXXTMKYKN 183 S Q EI+KLRHDVEEYA QFPTIGFE TMKYKN Sbjct: 483 SAFQSEISKLRHDVEEYAKQFPTIGFEKETMKYKN 517
>GLYM_FLAPR (P49357) Serine hydroxymethyltransferase 1, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 517 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -3 Query: 287 SNXQXEIAKLRHDVEEYAXQFPTIGFEXXTMKYKN 183 S Q EI+KLRHDVEEYA QFPTIGFE TMKYKN Sbjct: 483 SAIQSEISKLRHDVEEYAKQFPTIGFEKETMKYKN 517
>GLYM_SOLTU (P50433) Serine hydroxymethyltransferase, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 518 Score = 58.9 bits (141), Expect = 3e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 278 QXEIAKLRHDVEEYAXQFPTIGFEXXTMKYKN 183 + EIAKLRHDVEEYA QFPTIGFE TMKYKN Sbjct: 487 KSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN 518
>GLYM_ARATH (Q9SZJ5) Serine hydroxymethyltransferase, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 517 Score = 58.5 bits (140), Expect = 4e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 287 SNXQXEIAKLRHDVEEYAXQFPTIGFEXXTMKYKN 183 S Q EIAKLRH+VEE+A QFPTIGFE TMKYKN Sbjct: 483 STIQSEIAKLRHEVEEFAKQFPTIGFEKETMKYKN 517
>GLYM_PEA (P34899) Serine hydroxymethyltransferase, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 518 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 287 SNXQXEIAKLRHDVEEYAXQFPTIGFEXXTMKY 189 S Q EI+KL+HDVEE+A QFPTIGFE TMKY Sbjct: 484 SYVQSEISKLKHDVEEFAKQFPTIGFEKATMKY 516
>ARD1_RAT (P36407) GTP-binding protein ARD-1 (ADP-ribosylation factor domain| protein 1) (Tripartite motif protein 23) (Fragment) Length = 554 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 263 KLRHDVEEYAXQFPTIGFEXXTMKYKN*ALLCFNSKEANRKH 138 KL+ D E+ PTIGF T++YKN L F + KH Sbjct: 403 KLKQD--EFMQPIPTIGFNVETVEYKN---LKFTIWDVGEKH 439
>ARD1_MOUSE (Q8BGX0) GTP-binding protein ARD-1 (ADP-ribosylation factor domain| protein 1) (Tripartite motif protein 23) Length = 574 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 263 KLRHDVEEYAXQFPTIGFEXXTMKYKN*ALLCFNSKEANRKH 138 KL+ D E+ PTIGF T++YKN L F + KH Sbjct: 423 KLKQD--EFMQPIPTIGFNVETVEYKN---LKFTIWDVGGKH 459
>ARD1_HUMAN (P36406) GTP-binding protein ARD-1 (ADP-ribosylation factor domain| protein 1) (Tripartite motif protein 23) (RING finger protein 46) Length = 574 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 263 KLRHDVEEYAXQFPTIGFEXXTMKYKN*ALLCFNSKEANRKH 138 KL+ D E+ PTIGF T++YKN L F + KH Sbjct: 423 KLKQD--EFMQPIPTIGFNVETVEYKN---LKFTIWDVGGKH 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,155,758 Number of Sequences: 219361 Number of extensions: 540592 Number of successful extensions: 1430 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)