| Clone Name | rbaal13h20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CXA2_XENLA (P16864) Gap junction alpha-2 protein (Connexin-38) (... | 37 | 0.029 | 2 | VGFR1_HUMAN (P17948) Vascular endothelial growth factor receptor... | 29 | 7.9 |
|---|
>CXA2_XENLA (P16864) Gap junction alpha-2 protein (Connexin-38) (Cx38)| Length = 334 Score = 37.4 bits (85), Expect = 0.029 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 8/84 (9%) Frame = +3 Query: 330 QSQNSPQSSKTDGDLSSFSKTSGLY*CSA-----EAS*KAKCRSQCGHLNSGALS---SR 485 Q +P SS D DL S++K SG + S + + K + QC + A+S S Sbjct: 251 QEYTNPPSSNQDIDLPSYNKMSGGHNWSRIQMEQQVNGLVKPKCQCDCWSQSAISVVVSG 310 Query: 486 QVGIVSSLE*YKSNNKDKHVQQYV 557 GI+S+++ KSN++ QQYV Sbjct: 311 APGIISNMDAVKSNHQTSSKQQYV 334
>VGFR1_HUMAN (P17948) Vascular endothelial growth factor receptor 1 precursor (EC| 2.7.10.1) (VEGFR-1) (Vascular permeability factor receptor) (Tyrosine-protein kinase receptor FLT) (Flt-1) (Tyrosine-protein kinase FRT) (Fms-like tyrosine kinase 1) Length = 1338 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 294 TIITTS*VLKLMQSQNSPQSS-KTDGDLSSFSKTSGLY*CSAEAS*KAKCRSQCGHLNSG 470 T++ + + + + + P++S K D ++S SK SGL ++ S + C S CGH++ G Sbjct: 1248 TLLASPMLKRFTWTDSKPKASLKIDLRVTSKSKESGL----SDVSRPSFCHSSCGHVSEG 1303 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,297,672 Number of Sequences: 219361 Number of extensions: 1312797 Number of successful extensions: 2160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2160 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)