| Clone Name | rbaal13h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSID_SALTY (Q9FA43) Protein csiD | 30 | 3.6 | 2 | CSID_SALTI (Q8Z4G0) Protein csiD | 30 | 3.6 | 3 | CSID_ECOLI (P76621) Protein csiD | 29 | 8.1 |
|---|
>CSID_SALTY (Q9FA43) Protein csiD| Length = 325 Score = 30.0 bits (66), Expect = 3.6 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 167 LTPSLEMPKLDTXNLQAGXSLL--IEKWHNHLESXFAHSI 280 +T + M K+D N++ G SLL ++ W HLES F H + Sbjct: 169 VTDYVLMMKIDEQNMEGGNSLLLHLDDW-EHLESFFTHPL 207
>CSID_SALTI (Q8Z4G0) Protein csiD| Length = 325 Score = 30.0 bits (66), Expect = 3.6 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 167 LTPSLEMPKLDTXNLQAGXSLL--IEKWHNHLESXFAHSI 280 +T + M K+D N++ G SLL ++ W HLES F H + Sbjct: 169 VTDYVLMMKIDEQNMEGGNSLLLHLDDW-EHLESFFTHPL 207
>CSID_ECOLI (P76621) Protein csiD| Length = 325 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 167 LTPSLEMPKLDTXNLQAGXSLL--IEKWHNHLESXFAHSI 280 +T + M K+D N+Q G SLL ++ W HL++ F H + Sbjct: 169 ITDYVLMMKIDEQNMQGGNSLLLHLDDW-EHLDNYFRHPL 207 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,236,572 Number of Sequences: 219361 Number of extensions: 1024696 Number of successful extensions: 1630 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1628 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)