| Clone Name | rbaal13g18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CF060_HUMAN (Q8NB25) Protein C6orf60 | 28 | 5.9 | 2 | TMEM8_MOUSE (Q9ESN3) Transmembrane protein 8 precursor (M83 prot... | 28 | 7.7 |
|---|
>CF060_HUMAN (Q8NB25) Protein C6orf60| Length = 1020 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +3 Query: 45 SRMPLASTTGLLIIIQTSIT*ETLQNQISAANNIVKRNHDVIILYSNKIQKRNAAHE 215 S L S GL+ +Q S E LQN++ + +K D ++ ++++ HE Sbjct: 442 SEQGLGSAEGLIASLQDSQ--ERLQNELDLTKDSLKETKDALLNVEGELEQERQQHE 496
>TMEM8_MOUSE (Q9ESN3) Transmembrane protein 8 precursor (M83 protein)| Length = 769 Score = 27.7 bits (60), Expect = 7.7 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 166 TSWLRLTILLAADIWFCKVS*VMDVCMMINNPVVLARGI---LLAGSRLXLLPP 14 TSW R L I V M MM ++ I LLAGS LLPP Sbjct: 684 TSWQRWVFYLLPGISMASVGIAMYTSMMTSDNYYYTHSIWHILLAGSAAFLLPP 737 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,733,407 Number of Sequences: 219361 Number of extensions: 517176 Number of successful extensions: 902 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)