| Clone Name | rbaal13g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PNP_PHOLU (P41121) Polyribonucleotide nucleotidyltransferase (EC... | 28 | 4.5 | 2 | SYE2_COXBU (Q83BL6) Glutamyl-tRNA synthetase 2 (EC 6.1.1.17) (Gl... | 27 | 10.0 |
|---|
>PNP_PHOLU (P41121) Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)| (Polynucleotide phosphorylase) (PNPase) (CAP87K) Length = 709 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 146 LSFPAVAAVCGGS-GAPHLHQVADHRVHVLAEY 241 + F A A+ GG G H+ Q+AD RV +A+Y Sbjct: 633 VDFGAFVAIGGGKEGLVHISQIADKRVEKVADY 665
>SYE2_COXBU (Q83BL6) Glutamyl-tRNA synthetase 2 (EC 6.1.1.17) (Glutamate--tRNA| ligase 2) (GluRS 2) Length = 464 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -1 Query: 307 TSSMQVLLAMGFSYMQ-VMEAYSIFGEDMDSMICYLVE 197 T+ ++L A G Y + EA+ FG+D++S++ +L E Sbjct: 380 TAQSELLRATGNRYFEEAFEAFKKFGKDLNSVVSHLKE 417 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,535,474 Number of Sequences: 219361 Number of extensions: 661198 Number of successful extensions: 1824 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1824 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)