ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal12n14 |
|---|---|
| Clone Library Name | barley_pub |
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 33.5 bits (75), Expect = 0.42 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 238 GRLPVLAYIRCMCCKRSMCMPACSSRNRSSGTRTCLPVLIL-LNCNALC 95 G +P+ + +CC++S C PAC + ++S C+PV ++C +C Sbjct: 285 GSVPICSGASSLCCQQSSCQPACCTSSQSQ-QGCCVPVCCKPVSCVPVC 332 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + CC++S C PAC + R SS + C PV Sbjct: 329 VPVCSGASSSCCQQSSCQPACCTTSCCRPSSSVSLLCRPV 368
>KRA92_HUMAN (Q9BYQ4) Keratin-associated protein 9-2 (Keratin-associated protein| 9.2) (Ultrahigh sulfur keratin-associated protein 9.2) Length = 174 Score = 28.5 bits (62), Expect(2) = 1.2 Identities = 13/39 (33%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = -2 Query: 202 CCKRSMCMPAC---SSRNRSSGTRTCLPVLILLNCNALC 95 CC S C P C S +N T C P + C C Sbjct: 42 CCVSSCCQPCCRPTSCQNTCCRTTCCQPTCVTSCCQPSC 80 Score = 22.3 bits (46), Expect(2) = 1.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 80 VFCLCNMYWCTFVCFSTCIHKS 15 V+C Y+ T VC C+++S Sbjct: 114 VYCRRTCYYPTTVCLPGCLNQS 135
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPVLILLNCNALC 95 +PV + CC++S C PAC + R+ SS + C PV C + C Sbjct: 272 VPVCSGASTSCCQQSSCQPACCTASCCRSSSSVSLLCHPV-----CKSTC 316
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 31.2 bits (69), Expect = 2.1 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + +CC++S C PAC + R SS + C PV Sbjct: 177 VPVCSGASSLCCQKSSCQPACCTTSCCRPSSSVSLLCRPV 216 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 202 CCKRSMCMPACSSRNRSSGTRTCLPVLILLNC 107 CC++S C PAC + + C+PV NC Sbjct: 98 CCQQSSCQPACCTSSPCQ-QACCVPVCCKSNC 128
>HEM3_METCA (Q602K3) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 322 Score = 31.2 bits (69), Expect = 2.1 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 7/74 (9%) Frame = +1 Query: 13 SDLCIHVLKQTNVH-------QYILQRQKTRSCSYITHYSSTKSAPASKCECHSTYSLSC 171 +D+ +H +K V IL+R+ R Y S PA S+ C Sbjct: 87 ADIAVHSMKDVPVEFPEGLHLAAILEREDPRDALVSHRYRSFAELPADARIGTSSLRRQC 146 Query: 172 RLACTLTSCSTYTL 213 ++ C L CS Y L Sbjct: 147 QIKCRLPGCSLYDL 160
>TRDH_YMTV (Q6TUQ9) Transcript release DNA helicase (EC 3.6.1.-)| Length = 478 Score = 31.2 bits (69), Expect = 2.1 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 109 SSTKSAPASKCECHSTYSLSCRLACTLTSCSTYTLYKPGQVICLP 243 SS K K + T L+C T+T+C +++K VICLP Sbjct: 93 SSIKKKVELKRPMYVTLHLACGFGKTITTCYLLSVHKKKAVICLP 137
>TRDH_YLDV (Q9DHK3) Transcript release DNA helicase (EC 3.6.1.-)| Length = 479 Score = 31.2 bits (69), Expect = 2.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 154 TYSLSCRLACTLTSCSTYTLYKPGQVICLP 243 T L+C T+TSC +L+K VICLP Sbjct: 109 TLHLACGFGKTITSCYLLSLHKKKAVICLP 138
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + +CC++S C PAC + R SS + C PV Sbjct: 163 VPVCSGASSLCCQQSSCQPACCTTSCCRPSSSVSLLCRPV 202
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 30.0 bits (66), Expect = 4.6 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPVLILLNCNALC 95 +PV + CC++S C PAC + R SS + C PV C + C Sbjct: 158 VPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPV-----CKSTC 202
>MT_LIZAU (O13257) Metallothionein (MT)| Length = 60 Score = 30.0 bits (66), Expect = 4.6 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 139 CECHSTYSLSCRLACTLTSCSTYTLYKPGQVICLPYLP 252 CEC T SC +CT T+CS + K C P P Sbjct: 4 CECSKTGKCSCGGSCTCTNCSCTSCKKS----CCPCCP 37
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 30.0 bits (66), Expect = 4.6 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSSRNRSSGTRTCLPVLILLNCNALC 95 +PV CC++S C PAC + + S C+PV C +C Sbjct: 116 VPVCCGAASSCCRQSSCQPACCA-SSSCQPACCVPVC----CKPVC 156
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 30.0 bits (66), Expect = 4.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + +CC++S C PAC + R SS + C PV Sbjct: 199 VPVCSGASSLCCQQSGCQPACCTTSCCRPSSSVSLLCRPV 238
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 27.7 bits (60), Expect(2) = 5.3 Identities = 12/39 (30%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = -2 Query: 202 CCKRSMCMPAC---SSRNRSSGTRTCLPVLILLNCNALC 95 CC S C P C +N T C P+ + C C Sbjct: 37 CCVSSCCQPCCHPTCCQNTCCRTTCCQPICVTSCCQPSC 75 Score = 20.8 bits (42), Expect(2) = 5.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 80 VFCLCNMYWCTFVCFSTCIHKS 15 V+C Y T VC C+++S Sbjct: 99 VYCRRTCYHPTSVCLPGCLNQS 120
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + CC++S C PAC + R SS + C PV Sbjct: 277 VPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPV 316
>MT_PAGMA (Q9IB50) Metallothionein (MT)| Length = 60 Score = 29.6 bits (65), Expect = 6.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 139 CECHSTYSLSCRLACTLTSCSTYTLYK 219 CEC T + +C +CT T+CS T K Sbjct: 4 CECSKTGTCNCGGSCTCTNCSCTTCKK 30
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + CC++S C PAC + R SS + C PV Sbjct: 200 VPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPV 239 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSSRNRSSGTRTCLPVLILLNCNALC 95 LP + CC++S C P C + + SS C+PV C +C Sbjct: 111 LPTCSKDSSSCCQQSSCQPTCCA-SSSSQQSCCVPVC----CKPVC 151
>KRA59_HUMAN (P26371) Keratin-associated protein 5-9 (Keratin-associated protein| 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Frame = -2 Query: 211 RCMCCKR-----SMCMPACSSRNRSSG---TRTCLPVLILLNCNALC 95 +C CCK S C P CSS R S + C P C + C Sbjct: 98 QCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCGSSC 144
>CTCF_HUMAN (P49711) Transcriptional repressor CTCF (CCCTC-binding factor)| (CTCFL paralog) (11-zinc finger protein) Length = 727 Score = 29.3 bits (64), Expect = 7.9 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = +1 Query: 13 SDLCIHVLKQTNVHQYILQRQKTRSC--------SYITHYSSTKSAPASKCECHSTYSLS 168 SDL +H+ KQ H YI Q +K R C + I H S K+ KC+ Sbjct: 450 SDLGVHLRKQ---HSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCD-------Q 499 Query: 169 CRLAC 183 C AC Sbjct: 500 CDYAC 504
>CTCF_MOUSE (Q61164) Transcriptional repressor CTCF (CCCTC-binding factor)| (CTCFL paralog) (11-zinc finger protein) Length = 736 Score = 29.3 bits (64), Expect = 7.9 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = +1 Query: 13 SDLCIHVLKQTNVHQYILQRQKTRSC--------SYITHYSSTKSAPASKCECHSTYSLS 168 SDL +H+ KQ H YI Q +K R C + I H S K+ KC+ Sbjct: 450 SDLGVHLRKQ---HSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCD-------Q 499 Query: 169 CRLAC 183 C AC Sbjct: 500 CDYAC 504
>CTCF_RAT (Q9R1D1) Transcriptional repressor CTCF (CCCTC-binding factor)| (CTCFL paralog) (11-zinc finger protein) Length = 737 Score = 29.3 bits (64), Expect = 7.9 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = +1 Query: 13 SDLCIHVLKQTNVHQYILQRQKTRSC--------SYITHYSSTKSAPASKCECHSTYSLS 168 SDL +H+ KQ H YI Q +K R C + I H S K+ KC+ Sbjct: 450 SDLGVHLRKQ---HSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCD-------Q 499 Query: 169 CRLAC 183 C AC Sbjct: 500 CDYAC 504
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + CC++S C PAC + R SS + C P+ Sbjct: 189 VPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPI 228
>CTCF_CHICK (Q08705) Transcriptional repressor CTCF (CCCTC-binding factor)| (CTCFL paralog) (11-zinc finger protein) Length = 728 Score = 29.3 bits (64), Expect = 7.9 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = +1 Query: 13 SDLCIHVLKQTNVHQYILQRQKTRSC--------SYITHYSSTKSAPASKCECHSTYSLS 168 SDL +H+ KQ H YI Q +K R C + I H S K+ KC+ Sbjct: 450 SDLGVHLRKQ---HSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCD-------Q 499 Query: 169 CRLAC 183 C AC Sbjct: 500 CDYAC 504
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 29.3 bits (64), Expect = 7.9 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 232 LPVLAYIRCMCCKRSMCMPACSS----RNRSSGTRTCLPV 125 +PV + CC++S C PAC + R SS + C PV Sbjct: 199 VPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPV 238
>ZFYV1_MOUSE (Q810J8) Zinc finger FYVE domain-containing protein 1| Length = 777 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 220 AYIRCMCCKRSMCMPACSSRNRSSGTRTCLPVLILL 113 A +RC CK ++C+ C R S G + P+ + L Sbjct: 88 AAVRCQTCKINLCL-ECQKRTHSGGNKRRHPITVYL 122
>ZFYV1_HUMAN (Q9HBF4) Zinc finger FYVE domain-containing protein 1 (Double| FYVE-containing protein 1) (Tandem FYVE fingers-1) (SR3) Length = 777 Score = 29.3 bits (64), Expect = 7.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 238 GRLPVL---AYIRCMCCKRSMCMPACSSRNRSSGTRTCLPVLI 119 G LP + A +RC CK ++C+ C R S G + PV + Sbjct: 79 GHLPGVRQRAIVRCQTCKINLCL-ECQKRTHSGGNKRRHPVTV 120
>TRIB3_MOUSE (Q8K4K2) Tribbles homolog 3 (TRB-3) (Neuronal cell death-inducible| putative kinase) Length = 354 Score = 29.3 bits (64), Expect = 7.9 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = +1 Query: 1 PLPASDLCIHVLKQTNVHQYILQRQKTRSCSYITHYSST------KSAPASKCE 144 P PASDL V T + YIL ++ SCSY + T K PAS+ + Sbjct: 52 PPPASDLSPAVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEAQ 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,676,334 Number of Sequences: 219361 Number of extensions: 1512552 Number of successful extensions: 4267 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4230 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
