| Clone Name | rbaal6k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MQO_HELHP (Q7VFF6) Probable malate:quinone oxidoreductase (EC 1.... | 32 | 1.8 | 2 | MNR2_YEAST (P35724) Manganese resistance protein MNR2 | 32 | 1.8 | 3 | DIG1_CAEEL (Q09165) Mesocentin precursor | 30 | 5.2 | 4 | UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrola... | 30 | 6.8 |
|---|
>MQO_HELHP (Q7VFF6) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 494 Score = 32.0 bits (71), Expect = 1.8 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -2 Query: 620 TPERETIPQWMPFISTVKVLEDKPDLSRWTLKYAILGQDVEFSWLARNMTPTKNQK 453 T +RE I +W P + LE + + + + Y G DV+F +AR +QK Sbjct: 144 TEDREQIKEWAPLL-----LEGRGETQKMAVTYMAGGSDVDFGEIARQFGEKLSQK 194
>MNR2_YEAST (P35724) Manganese resistance protein MNR2| Length = 969 Score = 32.0 bits (71), Expect = 1.8 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 311 VSGLMQPGSEFQELHRPLLAVLYKRMNS*GRIGQRP 418 +SGL+QPG +FQ+L +A +Y + NS G I P Sbjct: 427 ISGLLQPGQKFQDL---FVASIYSQDNSAGHIKTHP 459
>DIG1_CAEEL (Q09165) Mesocentin precursor| Length = 13100 Score = 30.4 bits (67), Expect = 5.2 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = -2 Query: 542 SRWTLKYAILGQDVEFSWLARNMTPTKNQKIHWRSLEGLPNRGAVRFFPKSSSSCRVQLT 363 ++++L+ A + +D F+ +A+N N I+ +EGL F S ++ L Sbjct: 1871 AQFSLQVANITEDTTFNCVAQNPLGHANWTINVNLIEGLEPNWRDDFVTSKSDGGQIVLV 1930 Query: 362 VAYEVPEILNP 330 E+PE L P Sbjct: 1931 FNDELPEYLKP 1941
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 30.0 bits (66), Expect = 6.8 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +3 Query: 504 ILTKY-RILQSPTGKIWFIFKDLDS 575 +LT Y RIL+ PTG +W F D DS Sbjct: 182 LLTAYVRILKDPTGVLWHSFNDYDS 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,497,955 Number of Sequences: 219361 Number of extensions: 1875673 Number of successful extensions: 4140 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4139 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)