| Clone Name | rbaal13c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LYSC_LYSEN (Q7M135) Lysyl endopeptidase (EC 3.4.21.50) (Lys-C) | 31 | 1.9 | 2 | RHAR_YERPS (Q66FF1) HTH-type transcriptional activator rhaR (L-r... | 30 | 4.1 | 3 | RHAR_YERPE (Q8ZIZ9) HTH-type transcriptional activator rhaR (L-r... | 30 | 4.1 | 4 | HXAAB_BRARE (Q8AWY2) Homeobox protein Hox-A10b (Hox-A10) | 29 | 5.4 |
|---|
>LYSC_LYSEN (Q7M135) Lysyl endopeptidase (EC 3.4.21.50) (Lys-C)| Length = 269 Score = 30.8 bits (68), Expect = 1.9 Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +2 Query: 47 IFWSLVDG-PGPGVRREYIHQSTTRVLLQVRRCGGSCSVTGGDSRSEEMGRRCGSGNGAA 223 +FW G PG I+ RVL Q+ SCS TG D RS+ GR S G Sbjct: 180 VFWQASGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGAD-RSDYYGRVFTSWTGGG 238 Query: 224 EDDKSSLAVSPW 259 S+ +S W Sbjct: 239 ---TSATRLSDW 247
>RHAR_YERPS (Q66FF1) HTH-type transcriptional activator rhaR (L-rhamnose operon| transcriptional activator rhaR) Length = 290 Score = 29.6 bits (65), Expect = 4.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 89 REYIHQSTTRVLLQVRRCGGSCSVTGGDSRSEEMGRRCG 205 R+ S + L Q+R C C + G + R ++ RCG Sbjct: 214 RQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARCG 252
>RHAR_YERPE (Q8ZIZ9) HTH-type transcriptional activator rhaR (L-rhamnose operon| transcriptional activator rhaR) Length = 290 Score = 29.6 bits (65), Expect = 4.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 89 REYIHQSTTRVLLQVRRCGGSCSVTGGDSRSEEMGRRCG 205 R+ S + L Q+R C C + G + R ++ RCG Sbjct: 214 RQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAARCG 252
>HXAAB_BRARE (Q8AWY2) Homeobox protein Hox-A10b (Hox-A10)| Length = 330 Score = 29.3 bits (64), Expect = 5.4 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = +2 Query: 29 PNGNSFIFWSLVDGPGPGVRREYIH-----QSTTRVLLQVRRCGGSCSVTGGDSRSEEMG 193 P+GNSF+ SL+ G G Y + Q T+ + CG + +S S+ + Sbjct: 7 PSGNSFLVDSLIHGRSEGSGHYYQNSGVYLQPTSEYSYGLSNCGYFSGLKRNESNSQNVV 66 Query: 194 RRCGSGNG 217 CG G Sbjct: 67 PTCGPYQG 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,077,604 Number of Sequences: 219361 Number of extensions: 1112791 Number of successful extensions: 3764 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3763 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)