| Clone Name | rbaal13b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AP1G1_USTMA (Q99128) AP-1 complex subunit gamma-1 (Gamma(1)-adap... | 34 | 0.29 | 2 | TRIO_HUMAN (O75962) Triple functional domain protein (PTPRF-inte... | 29 | 7.3 |
|---|
>AP1G1_USTMA (Q99128) AP-1 complex subunit gamma-1 (Gamma(1)-adaptin) (Clathrin| assembly protein large gamma-1 chain) (Clathrin assembly protein complex 1 gamma-1 large chain) (Gamma-ADA) Length = 853 Score = 33.9 bits (76), Expect = 0.29 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 535 ICSMAEKFSQEKLWYLDQMFKVLSLSWHMLKETL 434 IC AEKF+ K W++D + +VL L+ + ++E + Sbjct: 406 ICLAAEKFAPNKRWHIDTVLRVLKLAGNYVREEI 439
>TRIO_HUMAN (O75962) Triple functional domain protein (PTPRF-interacting| protein) Length = 3038 Score = 29.3 bits (64), Expect = 7.3 Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = +1 Query: 46 HTFDHLNNHLEHTSYKKIRTIGYYERLQMVQNTQVCIYMHKVQ 174 H D ++ L H + +RTI + ++++ Q Q+C++ +VQ Sbjct: 477 HVLDVIHEVLHHQRH--VRTIWQHRKVRLHQRLQLCVFQQEVQ 517 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,792,772 Number of Sequences: 219361 Number of extensions: 1595198 Number of successful extensions: 3547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3546 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)