| Clone Name | rbaal13b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYP1_YEAST (P25623) Suppressor of yeast profilin deletion | 32 | 2.3 | 2 | YB79_YEAST (P38138) Putative family 31 glucosidase in FAT2-PBP2 ... | 32 | 2.3 | 3 | PSR1_YEAST (Q07800) Phosphatase PSR1 (EC 3.1.3.-) (Plasma membra... | 30 | 5.2 | 4 | ZCHC6_MOUSE (Q5BLK4) Zinc finger CCHC domain-containing protein 6 | 30 | 8.8 |
|---|
>SYP1_YEAST (P25623) Suppressor of yeast profilin deletion| Length = 870 Score = 31.6 bits (70), Expect = 2.3 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = -3 Query: 659 PSSASPTRSVRAYAKADEEEGEKKVP----KQSLFGNITEALDFSQVRSEKDAELLYEAR 492 P+SA+ R V A E EKK P ++S FGNI L + + + E Sbjct: 265 PASATGARPVSVSNGAANTEREKKSPQKDKRKSAFGNIGHRLASASSSLTHNDLMNNEFS 324 Query: 491 DSIKDEGRMTREQYAALRRKIGGTY 417 DS + +++ LR K+G + Sbjct: 325 DSTNNSSLKSKKSSHTLRSKVGSIF 349
>YB79_YEAST (P38138) Putative family 31 glucosidase in FAT2-PBP2 intergenic| region (EC 3.2.1.-) Length = 954 Score = 31.6 bits (70), Expect = 2.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 74 IYLECAYMLIKKYFTWTTHYYPDTLRL 154 I+L+ Y KKYFTW H +P+ RL Sbjct: 422 IWLDLEYTNDKKYFTWKQHSFPNPKRL 448
>PSR1_YEAST (Q07800) Phosphatase PSR1 (EC 3.1.3.-) (Plasma membrane sodium| response protein 1) Length = 427 Score = 30.4 bits (67), Expect = 5.2 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = -3 Query: 662 KPSSASPTRSVRAYAKADEEEGEKKVPKQSLFGNITEALDFSQVRSE---KDAELLYEAR 492 K +SPT +V A + + EK++ K L+ E + ++ E + ++ E Sbjct: 84 KKKPSSPTAAVTATTTNNMTKVEKRISKDDLYEEKYEVDEDEEIDDEDNRRSRGIVQEKG 143 Query: 491 DSIKDEGRMTREQ 453 D++KD R ++Q Sbjct: 144 DAVKDTSRQKKQQ 156
>ZCHC6_MOUSE (Q5BLK4) Zinc finger CCHC domain-containing protein 6| Length = 1491 Score = 29.6 bits (65), Expect = 8.8 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 7/90 (7%) Frame = -3 Query: 668 CFKPSSASPTRSVRAYAKADEEEGEKKVPKQSLFGNITEALDFSQVRSEKDAELLYEA-- 495 CF PS S T + + +EEE E++ + L N+TE D V +E + Y Sbjct: 828 CFSPSVQSRTSAAMHFDDEEEEEEEEEEEEPRLSINLTE--DEEGVANEHQVDSRYAGSG 885 Query: 494 -RDSIKDEGRMTR----EQYAALRRKIGGT 420 D++ +E + E +GGT Sbjct: 886 EEDALSEEDDLAEPAKGEDTGECGENVGGT 915 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,752,325 Number of Sequences: 219361 Number of extensions: 1918387 Number of successful extensions: 6466 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6439 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)