| Clone Name | rbaal12l09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MLH3_HUMAN (Q9UHC1) DNA mismatch repair protein Mlh3 (MutL prote... | 30 | 6.9 | 2 | RISA_BUCAI (P57212) Riboflavin synthase alpha chain (EC 2.5.1.9) | 29 | 9.0 |
|---|
>MLH3_HUMAN (Q9UHC1) DNA mismatch repair protein Mlh3 (MutL protein homolog 3)| Length = 1453 Score = 29.6 bits (65), Expect = 6.9 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 424 ELSRTSKSNGS*IPMSTLRRSIRSKQRVMADVKCNYILNKYKMHNI 561 ++ S+ NG + +TL++ + S +R CN IL+ Y+M N+ Sbjct: 361 DIKEFSEDNGFSLFDATLQKRVTSDERSNFQEACNNILDSYEMFNL 406
>RISA_BUCAI (P57212) Riboflavin synthase alpha chain (EC 2.5.1.9)| Length = 208 Score = 29.3 bits (64), Expect = 9.0 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 189 IEKNDDLPTTAKHEGCCLPILLCKRPVLISASLQDTKNSS 70 + KN L + H GCCL + L +I +Q+T S+ Sbjct: 32 LSKNLKLGDSISHNGCCLTVKLINNSFIICDVIQETLKST 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,815,301 Number of Sequences: 219361 Number of extensions: 1494494 Number of successful extensions: 3489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3489 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)