| Clone Name | rbaal12k07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y5541_ARATH (Q9FKP8) ZF-HD homeobox protein At5g65410 | 30 | 5.7 | 2 | CST11_RAT (Q8K5A3) Cystatin-11 precursor | 29 | 7.5 | 3 | GML_HUMAN (Q99445) Glycosyl-phosphatidylinositol-anchored molecu... | 29 | 9.7 |
|---|
>Y5541_ARATH (Q9FKP8) ZF-HD homeobox protein At5g65410| Length = 279 Score = 29.6 bits (65), Expect = 5.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 362 FCGERLVAVIVALVWQHDHRGSVYRLPSLLHQAFECPPP 478 FC E V V VW H+++ ++ + PS LH PPP Sbjct: 228 FCQETGVPRQVLKVWLHNNKHTLGKSPSPLHHHQAPPPP 266
>CST11_RAT (Q8K5A3) Cystatin-11 precursor| Length = 139 Score = 29.3 bits (64), Expect = 7.5 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 223 HLTTTVQKTVHYNTTPHTTNIMKGGFHSHRCHYVGLARLPILSAWKLLR 369 H+T +Q+T T + N+ +G H Y + +P L +K+L+ Sbjct: 84 HITVEMQRTTCLKTEKNLCNVQEGELHKQIQCYFSVYVIPWLEVFKMLK 132
>GML_HUMAN (Q99445) Glycosyl-phosphatidylinositol-anchored molecule-like| protein precursor Length = 158 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 228 YYNCTKNCXLQHNASHYKYHEGRIPFT*MSLRWSCTSSDSVC 353 Y NCT NC + A G+I F S W C + VC Sbjct: 70 YKNCTNNCTFVYAAEQPPEAPGKI-FKTNSFYWVCCCNSMVC 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,062,568 Number of Sequences: 219361 Number of extensions: 1525144 Number of successful extensions: 3677 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3677 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)