| Clone Name | rbaal12j05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RDS3_YEAST (Q06835) Pre-mRNA-splicing factor RDS3 (Regulator of ... | 33 | 0.77 | 2 | TNR8_HUMAN (P28908) Tumor necrosis factor receptor superfamily m... | 31 | 3.8 | 3 | VIPR_CARAU (Q90308) Vasoactive intestinal polypeptide receptor (... | 30 | 5.0 | 4 | RCOR3_CHICK (Q5ZJ40) REST corepressor 3 | 30 | 6.5 | 5 | TNR27_HUMAN (Q9HAV5) Tumor necrosis factor receptor superfamily ... | 30 | 8.5 |
|---|
>RDS3_YEAST (Q06835) Pre-mRNA-splicing factor RDS3 (Regulator of drug| sensitivity 3) Length = 107 Score = 33.1 bits (74), Expect = 0.77 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = -1 Query: 280 KEEGMSSGYSLK*VDDSTPLCICMETPKRILRENSNCS--TQITGCSSLLPFALVLDLAV 107 K+ G+ +G + D P+C PKR +R NCS Q C + + ++ A Sbjct: 13 KQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNC-IICNLNVGVNDAF 71 Query: 106 YCWLCFGTG 80 YCW C G Sbjct: 72 YCWECCRLG 80
>TNR8_HUMAN (P28908) Tumor necrosis factor receptor superfamily member 8| precursor (CD30L receptor) (Lymphocyte activation antigen CD30) (KI-1 antigen) Length = 595 Score = 30.8 bits (68), Expect = 3.8 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 3/83 (3%) Frame = +1 Query: 244 ISSCSHCSFLPL*-TGIHYMVPASIFRCCICRDRRAASGGLCSSSPPANCASTSLSAVD* 420 ++SC+ C F + G+ P + + +C C+S P NC S + Sbjct: 119 VNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACAS--PENCKEPSSGTIPQ 176 Query: 421 AQRFPQSACPSSA--LPTRHGAR 483 A+ P S SSA +P R G R Sbjct: 177 AKPTPVSPATSSASTMPVRGGTR 199
>VIPR_CARAU (Q90308) Vasoactive intestinal polypeptide receptor (VIP-R) (VIP| receptor) Length = 447 Score = 30.4 bits (67), Expect = 5.0 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 193 ILRENSNCSTQITGCSSLLPFALVLDLAVYCWL 95 +++E+ NCST GC +++ F +A + WL Sbjct: 163 VIQESDNCSTASVGCKAVIVFFQYCIMASFFWL 195
>RCOR3_CHICK (Q5ZJ40) REST corepressor 3| Length = 378 Score = 30.0 bits (66), Expect = 6.5 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +1 Query: 346 AASGGLCSSSPPANCASTSLSAVD*AQRFPQSACPSSALPT 468 A+S CS SPP+ A+ + A+ A+ P+SA P++ P+ Sbjct: 338 ASSTSCCSCSPPSASAAPTTGAIYSAKANPKSASPTAHPPS 378
>TNR27_HUMAN (Q9HAV5) Tumor necrosis factor receptor superfamily member 27| (X-linked ectodysplasin-A2 receptor) (EDA-A2 receptor) Length = 297 Score = 29.6 bits (65), Expect = 8.5 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = +1 Query: 121 GQGQKVEENCSLLS---AYCSCYFPSRSF*ESPYRYRAEWNHQLISSCSHCSFL 273 G GQ++ ++C AYC+ P RY++ W H SC C+ + Sbjct: 22 GPGQELSKDCGYGEGGDAYCTAC--------PPRRYKSSWGHHRCQSCITCAVI 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,189,750 Number of Sequences: 219361 Number of extensions: 1536705 Number of successful extensions: 3721 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3719 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)