| Clone Name | rbaal12h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPNK_BUCBP (Q89AR9) Probable inorganic polyphosphate/ATP-NAD kin... | 31 | 3.1 | 2 | PSTB_MYCLE (Q50046) Phosphate import ATP-binding protein pstB (E... | 30 | 4.0 |
|---|
>PPNK_BUCBP (Q89AR9) Probable inorganic polyphosphate/ATP-NAD kinase (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase) Length = 292 Score = 30.8 bits (68), Expect = 3.1 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Frame = +3 Query: 102 SSILLP*ETHVMAELKQNCPSMVSKPSNS---AFVERIVRFF-LIHPTSFG*F 248 S + L + H+ +ELK +C S V P NS FV++ +F L+HP ++ F Sbjct: 227 SIVYLKFKKHIHSELKISCDSQVILPLNSKDNIFVKKSKKFLCLLHPKNYNYF 279
>PSTB_MYCLE (Q50046) Phosphate import ATP-binding protein pstB (EC 3.6.3.27)| (Phosphate-transporting ATPase) (ABC phosphate transporter) Length = 258 Score = 30.4 bits (67), Expect = 4.0 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -1 Query: 537 MANHFDVLGVTIFFGTAMRLMNIQIGELSRRAWLGEGADLLNSDNLLRTYN 385 MA D+ GV I++G+ ++++ + L R GA +LRT N Sbjct: 1 MAKRLDLKGVNIYYGSFQAVLDVSLAVLPRSVTAFIGASGCGKTTVLRTLN 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,089,816 Number of Sequences: 219361 Number of extensions: 1839006 Number of successful extensions: 4635 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4635 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)