| Clone Name | rbaal6k02 |
|---|---|
| Clone Library Name | barley_pub |
>FTRC_MAIZE (P41347) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) Length = 152 Score = 80.5 bits (197), Expect = 2e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAISLEEIKEATSKY 318 VPMRERKECHCMLFLTPDNDFAG+DQ IS EEIKEATSK+ Sbjct: 113 VPMRERKECHCMLFLTPDNDFAGKDQVISFEEIKEATSKF 152
>FTRC_SOYBN (O49856) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) Length = 144 Score = 72.4 bits (176), Expect = 5e-13 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAISLEEIKEATS 324 VPMRERKECHCMLFLTPDNDFAG +Q I+L+EIKE+T+ Sbjct: 105 VPMRERKECHCMLFLTPDNDFAGNEQTITLDEIKESTA 142
>FTRC1_SPIOL (P41348) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) (B2) Length = 144 Score = 72.4 bits (176), Expect = 5e-13 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAISLEEIKEATS 324 VPMRERKECHCMLFLTPDNDFAG++Q I+L+EI+E TS Sbjct: 105 VPMRERKECHCMLFLTPDNDFAGKEQTITLDEIREVTS 142
>FTRC2_SPIOL (P41349) Ferredoxin-thioredoxin reductase catalytic chain,| chloroplast precursor (EC 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) (B1) Length = 148 Score = 70.9 bits (172), Expect = 1e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAISLEEIKEATS 324 VPMRERKECHCMLFLTP+NDFAG+DQ I L+EI+E T+ Sbjct: 109 VPMRERKECHCMLFLTPENDFAGKDQTIGLDEIREVTA 146
>FTRC_CYACA (Q9TM25) Ferredoxin-thioredoxin reductase, catalytic chain (EC| 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) Length = 111 Score = 57.4 bits (137), Expect = 2e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAISLEEIKEATS 324 VPMRERKECHCMLFL P N+F+GE Q IS +++++ S Sbjct: 74 VPMRERKECHCMLFLQPSNEFSGESQLISKDDLQKHLS 111
>FTRC_GUITH (O78461) Ferredoxin-thioredoxin reductase, catalytic chain (EC| 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) Length = 102 Score = 53.5 bits (127), Expect = 2e-07 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAI 354 VPMRERKECHCMLFLT DN+FAG Q + Sbjct: 75 VPMRERKECHCMLFLTKDNEFAGSSQTL 102
>FTRC_PORPU (P51386) Ferredoxin-thioredoxin reductase, catalytic chain (EC| 1.18.-.-) (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) Length = 118 Score = 52.8 bits (125), Expect = 4e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -2 Query: 437 VPMRERKECHCMLFLTPDNDFAGEDQAISLEEIKE 333 VPMRERKECHCMLFLTPDN+F + Q I + E Sbjct: 79 VPMRERKECHCMLFLTPDNEFTSDLQEIDKTTLLE 113
>PRL_ICTPU (P51904) Prolactin precursor (PRL)| Length = 212 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 268 TDRL*PPLEQKQALSG*YLDVASLISSKLMAWSSPAKSLSGVRKSM 405 T L P ++ QALS ++ SL+ S LMAWS P LS S+ Sbjct: 73 TSSLQIPNDKDQALSVPEGELLSLVRSLLMAWSDPLALLSSEATSL 118
>PRL_DICLA (P48249) Prolactin precursor (PRL)| Length = 212 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 268 TDRL*PPLEQKQALSG*YLDVASLISSKLMAWSSPAKSLS 387 T L P++++QAL D+ SL+ S L AW P LS Sbjct: 72 TSSLHTPIDKEQALQVSEADLLSLVRSLLQAWRDPLVILS 111
>PRL2_OREMO (P09318) Prolactin-2 precursor (Prolactin II) (PRL-177)| Length = 200 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 268 TDRL*PPLEQKQALSG*YLDVASLISSKLMAWSSPAKSLS 387 T L P +++QAL D+ SL S L AWS P + LS Sbjct: 66 TSSLQTPTDKEQALQVSESDLLSLARSLLQAWSDPLEVLS 105
>PRL1_OREMO (P09319) Prolactin-1 precursor (Prolactin I) (PRL-188)| Length = 212 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +1 Query: 268 TDRL*PPLEQKQALSG*YLDVASLISSKLMAWSSPAKSLS 387 T L P+++ QAL D+ SL S L AWS P LS Sbjct: 72 TSSLQTPIDKDQALQVSESDLMSLARSLLQAWSDPLVVLS 111
>LPS1B_LYTPI (Q03975) Calcium-binding protein LPS1-beta (Fragment)| Length = 243 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 21 GRRRFTRHPSFLASFLSQWSRVYASPKTRNKFGNIDKPGNATIRP 155 GR +F ++ + + R+Y+S + + F ++DK GN I P Sbjct: 65 GRMQFDEFLLYMEGYTKE--RLYSSDEIKQMFDDLDKDGNGRISP 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,925,520 Number of Sequences: 219361 Number of extensions: 1122473 Number of successful extensions: 2598 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2597 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)