ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal12g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CY561_SHEEP (Q95204) Cytochrome b561 (Cytochrome b-561) | 48 | 4e-10 | 2 | CY561_BOVIN (P10897) Cytochrome b561 (Cytochrome b-561) | 48 | 4e-10 | 3 | CY561_MOUSE (Q60720) Cytochrome b561 (Cytochrome b-561) | 50 | 4e-10 | 4 | CY561_PONPY (Q5RCZ2) Cytochrome b561 (Cytochrome b-561) | 50 | 5e-10 | 5 | CY561_HUMAN (P49447) Cytochrome b561 (Cytochrome b-561) | 50 | 5e-10 | 6 | CY561_XENLA (Q91577) Cytochrome b561 (Cytochrome b-561) | 49 | 2e-08 | 7 | CY561_PIG (Q95245) Cytochrome b561 (Cytochrome b-561) | 45 | 3e-08 | 8 | CY561_CAEEL (P34465) Putative cytochrome b561 (Cytochrome b-561) | 51 | 5e-08 | 9 | CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precu... | 29 | 8.3 |
|---|
>CY561_SHEEP (Q95204) Cytochrome b561 (Cytochrome b-561)| Length = 252 Score = 47.8 bits (112), Expect(2) = 4e-10 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPGS 397 G A+LYSLHSW GI +L+ QW+ GF F FPG+ Sbjct: 114 GYADLYSLHSWCGILVFALFFAQWLVGFSFFLFPGA 149 Score = 35.4 bits (80), Expect(2) = 4e-10 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++L++ATA LG E + F + + PE +L N Sbjct: 159 PQHVFFGAAIFLLSVATALLGLKEALLFELGTKYSTFEPEGVLAN 203
>CY561_BOVIN (P10897) Cytochrome b561 (Cytochrome b-561)| Length = 252 Score = 47.8 bits (112), Expect(2) = 4e-10 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPGS 397 G A+LYSLHSW GI +L+ QW+ GF F FPG+ Sbjct: 114 GYADLYSLHSWCGILVFALFFAQWLVGFSFFLFPGA 149 Score = 35.4 bits (80), Expect(2) = 4e-10 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++L++ATA LG E + F + + PE +L N Sbjct: 159 PQHVFFGAAIFLLSVATALLGLKEALLFELGTKYSMFEPEGVLAN 203
>CY561_MOUSE (Q60720) Cytochrome b561 (Cytochrome b-561)| Length = 250 Score = 49.7 bits (117), Expect(2) = 4e-10 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPGS 397 G A+LYSLHSW GI LY +QW+ GF F FPG+ Sbjct: 112 GYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGA 147 Score = 33.5 bits (75), Expect(2) = 4e-10 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++ ++ TA LG E + F S + PE +L N Sbjct: 157 PQHIFFGATIFLFSVGTALLGLKEALLFKLGSKYSTFEPEGVLAN 201
>CY561_PONPY (Q5RCZ2) Cytochrome b561 (Cytochrome b-561)| Length = 251 Score = 49.7 bits (117), Expect(2) = 5e-10 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPGS 397 G A+LYSLHSW GI LY +QW+ GF F FPG+ Sbjct: 113 GYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGA 148 Score = 33.1 bits (74), Expect(2) = 5e-10 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++L++ TA LG E + F + PE +L N Sbjct: 158 PQHIFFGATIFLLSVGTALLGLKEALLFKLRDKYSAFEPEGVLAN 202
>CY561_HUMAN (P49447) Cytochrome b561 (Cytochrome b-561)| Length = 251 Score = 49.7 bits (117), Expect(2) = 5e-10 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPGS 397 G A+LYSLHSW GI LY +QW+ GF F FPG+ Sbjct: 113 GYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGA 148 Score = 33.1 bits (74), Expect(2) = 5e-10 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++L++ TA LG E + F + PE +L N Sbjct: 158 PQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSAFEPEGVLAN 202
>CY561_XENLA (Q91577) Cytochrome b561 (Cytochrome b-561)| Length = 247 Score = 48.9 bits (115), Expect(2) = 2e-08 Identities = 20/35 (57%), Positives = 24/35 (68%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPG 400 G ++YSLHSW GI +LY +QWI GF FF PG Sbjct: 113 GYPDMYSLHSWCGIVTFTLYILQWIIGFSLFFIPG 147 Score = 28.5 bits (62), Expect(2) = 2e-08 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++ ++AT+ LG EKM SS + E +LVN Sbjct: 158 PLHEFFGRALFLSSIATSLLGLTEKMFSEYSS----HPAEGILVN 198
>CY561_PIG (Q95245) Cytochrome b561 (Cytochrome b-561)| Length = 252 Score = 45.4 bits (106), Expect(2) = 3e-08 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = -3 Query: 504 GIANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPGS 397 GIA+LYSLHSW GI L+ QW+ G F FPG+ Sbjct: 114 GIADLYSLHSWCGILVFVLFLAQWLVGLGFFLFPGA 149 Score = 31.2 bits (69), Expect(2) = 3e-08 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEKMTFLQSSGLDKYGPEALLVN 233 P H FG +++L++ TA LG E + F + + E +L N Sbjct: 159 PQHVFFGAAIFLLSVGTALLGLKEALLFQLGTKYSAFESEGVLAN 203
>CY561_CAEEL (P34465) Putative cytochrome b561 (Cytochrome b-561)| Length = 266 Score = 50.8 bits (120), Expect(2) = 5e-08 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = -3 Query: 501 IANLYSLHSWLGIGAISLYGIQWIFGFVTFFFPG 400 I NL SLHSW+G+ + LY Q+I GF+T+FFPG Sbjct: 132 IVNLVSLHSWIGLSVVILYFAQYIVGFITYFFPG 165 Score = 25.0 bits (53), Expect(2) = 5e-08 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -2 Query: 367 PWHALFGLFVYVLTLATAELGFLEK 293 P+H +FG+ +++ T +G E+ Sbjct: 176 PFHQMFGVLIFIFVSITVAMGISER 200
>CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 340 Score = 28.9 bits (63), Expect = 8.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 23 PDLVEPITHVVSLGTNQTFNNQQHVALYGTRLL 121 PD + THV ++ Q FN+Q+ VAL G L Sbjct: 194 PDASQGATHVRNVFNRQGFNDQEMVALIGAHAL 226 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,604,923 Number of Sequences: 219361 Number of extensions: 810058 Number of successful extensions: 2852 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2852 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
