| Clone Name | rbaal12e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HUL4_YEAST (P40985) Probable ubiquitin-protein ligase HUL4 (EC 6... | 30 | 6.2 | 2 | YMO3_YEAST (Q03673) Hypothetical 22.7 kDa protein in CDC5-MVP1 i... | 30 | 6.2 | 3 | MRAZ_BACFR (Q64ZL3) Protein mraZ | 30 | 8.0 | 4 | MRAZ_BACFN (Q5LII9) Protein mraZ | 30 | 8.0 |
|---|
>HUL4_YEAST (P40985) Probable ubiquitin-protein ligase HUL4 (EC 6.3.2.-) (HECT| ubiquitin ligase 4) Length = 892 Score = 30.0 bits (66), Expect = 6.2 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = -2 Query: 624 VGHCEDRLEQRGRRSEEKIA*VGRQQGASVSRPGMKQLIVYMISRDGVRSQVDLPKMCKM 445 V H ++RL + GRR+ E+ + G+ + K+ S V + D + + Sbjct: 28 VAHTKNRLPKSGRRTSERSLAASVKDGSCSNSKSNKR-----NSSASVSGEEDKSCLISL 82 Query: 444 HCSSCNPPLKFRTS 403 +C C PL+F S Sbjct: 83 NCLCCGVPLRFPAS 96
>YMO3_YEAST (Q03673) Hypothetical 22.7 kDa protein in CDC5-MVP1 intergenic| region Length = 198 Score = 30.0 bits (66), Expect = 6.2 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 459 KMCKMHCSSCNPPLKFRTSDLLSRLRNHDSSGN 361 K+ K C S L R SDLL RL HDS N Sbjct: 75 KVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSN 107
>MRAZ_BACFR (Q64ZL3) Protein mraZ| Length = 158 Score = 29.6 bits (65), Expect = 8.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 602 WNKEVGEARKRLHKWEGN 549 WN+E+ E R+RL+KW N Sbjct: 55 WNEELDELRQRLNKWNAN 72
>MRAZ_BACFN (Q5LII9) Protein mraZ| Length = 158 Score = 29.6 bits (65), Expect = 8.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 602 WNKEVGEARKRLHKWEGN 549 WN+E+ E R+RL+KW N Sbjct: 55 WNEELDELRQRLNKWNAN 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,170,849 Number of Sequences: 219361 Number of extensions: 1812517 Number of successful extensions: 4128 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4127 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6086476506 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)