| Clone Name | rbaal12d16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1770_SYNY3 (P73627) Hypothetical protein sll1770 | 45 | 1e-04 | 2 | TF2AA_RAT (O08949) Transcription initiation factor IIA subunit 1... | 32 | 1.3 | 3 | TF2AA_PONPY (Q5RCU0) Transcription initiation factor IIA subunit... | 32 | 1.3 | 4 | TF2AA_HUMAN (P52655) Transcription initiation factor IIA subunit... | 32 | 1.3 | 5 | TF2AA_MOUSE (Q99PM3) Transcription initiation factor IIA subunit... | 32 | 1.3 |
|---|
>Y1770_SYNY3 (P73627) Hypothetical protein sll1770| Length = 585 Score = 45.1 bits (105), Expect = 1e-04 Identities = 22/60 (36%), Positives = 38/60 (63%) Frame = -1 Query: 568 EIRKQANDARDSTISMPYRIQRIEDFVGQLESGDLKLRVRVLESERAARKANVLQMATMY 389 E+ +QA +S + +P +RIED + +L+ GD+++RVR E++R R+ +QM T Y Sbjct: 478 ELGRQAVQVGNSALGLP---RRIEDSLDRLDRGDIRVRVRSTETDRLLRRMGTMQMGTNY 534
>TF2AA_RAT (O08949) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFIIA p19 subunit)] Length = 377 Score = 32.0 bits (71), Expect = 1.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 269 DAKSEETREIRDDDVIAVLHYGNVHKNQDKWFTSVK----KLNGNCFLIHR 129 D EE +E+ D + + V Y +H++++KW +K LNG ++ + Sbjct: 320 DVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSK 370
>TF2AA_PONPY (Q5RCU0) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFIIA p19 subunit)] Length = 376 Score = 32.0 bits (71), Expect = 1.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 269 DAKSEETREIRDDDVIAVLHYGNVHKNQDKWFTSVK----KLNGNCFLIHR 129 D EE +E+ D + + V Y +H++++KW +K LNG ++ + Sbjct: 319 DVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSK 369
>TF2AA_HUMAN (P52655) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) (TFIIA-42) (TFIIAL) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFI Length = 376 Score = 32.0 bits (71), Expect = 1.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 269 DAKSEETREIRDDDVIAVLHYGNVHKNQDKWFTSVK----KLNGNCFLIHR 129 D EE +E+ D + + V Y +H++++KW +K LNG ++ + Sbjct: 319 DVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSK 369
>TF2AA_MOUSE (Q99PM3) Transcription initiation factor IIA subunit 1 (General| transcription factor IIA1) [Contains: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Transcription initiation factor IIA beta chain (TFIIA p19 subunit)] Length = 378 Score = 32.0 bits (71), Expect = 1.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 269 DAKSEETREIRDDDVIAVLHYGNVHKNQDKWFTSVK----KLNGNCFLIHR 129 D EE +E+ D + + V Y +H++++KW +K LNG ++ + Sbjct: 321 DVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSK 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,594,486 Number of Sequences: 219361 Number of extensions: 1601967 Number of successful extensions: 3912 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3912 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)