| Clone Name | rbaal11l07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ANTR2_HUMAN (P58335) Anthrax toxin receptor 2 precursor (Capilla... | 29 | 3.7 | 2 | UBQL3_MOUSE (Q8C5U9) Ubiquilin-3 | 28 | 4.8 | 3 | TNFA_SPAAU (Q8JFG3) Tumor necrosis factor (TNF-alpha) | 28 | 6.3 | 4 | STHY_ARATH (Q9SYM2) Putative salt tolerance-like protein At1g78600 | 28 | 8.2 | 5 | NMNA3_HUMAN (Q96T66) Nicotinamide mononucleotide adenylyltransfe... | 28 | 8.2 | 6 | VG51_SHV21 (Q01036) Gene 51 glycoprotein | 28 | 8.2 |
|---|
>ANTR2_HUMAN (P58335) Anthrax toxin receptor 2 precursor (Capillary| morphogenesis gene 2 protein) (CMG-2) Length = 489 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +3 Query: 24 ILQVQPPSEAMGESTRTKFHHRNFKITTR----FCTATYSSTLCTSSAP 158 IL++QP S +GE + R F + +R CT T + T TS P Sbjct: 221 ILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKP 269
>UBQL3_MOUSE (Q8C5U9) Ubiquilin-3| Length = 658 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 111 FCTATYSSTLCTSSAP-QNNNSDHLKPPWS 197 F TAT +ST TSS P + N D L PW+ Sbjct: 278 FVTATTASTTTTSSQPSRTENCDPLPNPWT 307
>TNFA_SPAAU (Q8JFG3) Tumor necrosis factor (TNF-alpha)| Length = 253 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 55 WANPQGQSFTTGTLRL-QHVFALPPTPPHFVHPQ 153 W N QGQ+F G RL + +P T +FV+ Q Sbjct: 116 WKNGQGQAFAQGGFRLVDNKIVIPHTGLYFVYSQ 149
>STHY_ARATH (Q9SYM2) Putative salt tolerance-like protein At1g78600| Length = 299 Score = 27.7 bits (60), Expect = 8.2 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 Query: 15 AWVILQVQPPSEAMGESTRTKFHHRNFKITTRFCTATYSSTLCTSSAP 158 +W + Q+Q P A G + FHH + F SST T S+P Sbjct: 246 SWAVPQIQSPPTASGLNWPKHFHHHSV-----FVPDITSSTPYTGSSP 288
>NMNA3_HUMAN (Q96T66) Nicotinamide mononucleotide adenylyltransferase 3 (EC| 2.7.7.1) (NMN adenylyltransferase 3) Length = 252 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 40 LRRKPWANPQGQSFTTGTLRLQHVFALPPTPPHFVHPQHPKIIIQT 177 +R PW + Q Q T + H L +PP P H K + T Sbjct: 78 IRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFST 123
>VG51_SHV21 (Q01036) Gene 51 glycoprotein| Length = 269 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 30 QVQPPSEAMGESTRTKFHHRNFKITTRFCTATYSSTLCTSSAPQNNNS 173 ++ P S++ +ST+T T++ T+ S+ + TS P +NN+ Sbjct: 116 KLTPKSQSSSQSTKTTKQASKNLTTSKLATSFSSTYMTTSDQPYSNNT 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,203,831 Number of Sequences: 219361 Number of extensions: 678136 Number of successful extensions: 2134 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2134 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)