| Clone Name | rbaal6j07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATRIP_MACFA (Q9N077) ATR-interacting protein (ATM and Rad3-relat... | 30 | 5.7 | 2 | LEU2_AQUAE (O67078) 3-isopropylmalate dehydratase large subunit ... | 30 | 5.7 |
|---|
>ATRIP_MACFA (Q9N077) ATR-interacting protein (ATM and Rad3-related-interacting| protein) (Fragment) Length = 655 Score = 30.0 bits (66), Expect = 5.7 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +2 Query: 371 SPAISVTGRTSAHELLSALPDVDHDDVVLCGHLPCLFPLL 490 SP + G A ELLS L D D LC H CL LL Sbjct: 460 SPETPLPGMVLAVELLSLLADHDQLAPQLCSHSDCLLLLL 499
>LEU2_AQUAE (O67078) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 432 Score = 30.0 bits (66), Expect = 5.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 594 IRRAPKHPWLHLRDDPDGPLHVLHERDAGWWQPM 493 +++ K PW + DPD H ++E DA +P+ Sbjct: 237 VKQRAKRPWKVYQSDPDAEYHSVYEWDASQIEPL 270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,039,903 Number of Sequences: 219361 Number of extensions: 1511394 Number of successful extensions: 4218 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4217 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)