| Clone Name | rbaal11i05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxid... | 32 | 1.5 | 2 | GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxid... | 32 | 1.5 | 3 | IL21R_HUMAN (Q9HBE5) Interleukin-21 receptor precursor (IL-21R) ... | 29 | 9.6 |
|---|
>GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 (EC| 1.1.3.15) (Glycolate oxidase 2) (GOX 2) (Short chain alpha-hydroxy acid oxidase 2) Length = 367 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +2 Query: 227 RLLDYAPATISALEEVQRCT 286 R LDY PATISALEEV + T Sbjct: 257 RQLDYVPATISALEEVVKAT 276
>GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 (EC| 1.1.3.15) (Glycolate oxidase 1) (GOX 1) (Short chain alpha-hydroxy acid oxidase 1) Length = 367 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +2 Query: 227 RLLDYAPATISALEEVQRCT 286 R LDY PATISALEEV + T Sbjct: 257 RQLDYVPATISALEEVVKAT 276
>IL21R_HUMAN (Q9HBE5) Interleukin-21 receptor precursor (IL-21R) (Novel| interleukin receptor) Length = 538 Score = 29.3 bits (64), Expect = 9.6 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 160 GGWSCPLKNCLMN*KVXTSCLVHVPNQHCNALTHVW 53 GGW CP C + C++ + N H + LT W Sbjct: 16 GGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTW 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,227,912 Number of Sequences: 219361 Number of extensions: 1689039 Number of successful extensions: 3744 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3744 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)