| Clone Name | rbaal11g21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DBP9_SCHPO (O60080) ATP-dependent RNA helicase dbp9 (EC 3.6.1.-) | 30 | 5.7 | 2 | YL613_MIMIV (Q5UP74) Hypothetical protein L613 | 30 | 5.7 | 3 | JPH3_MOUSE (Q9ET77) Junctophilin-3 (Junctophilin type 3) (JP-3) | 29 | 9.7 |
|---|
>DBP9_SCHPO (O60080) ATP-dependent RNA helicase dbp9 (EC 3.6.1.-)| Length = 595 Score = 30.0 bits (66), Expect = 5.7 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 197 GGLRDKANFI*IVTTFSDFSLNPRTEKGGEFCLFSKSDS 313 GG+R++++ TFSDF+L+PR ++ C F K S Sbjct: 5 GGIREESS----EKTFSDFNLDPRLQRAIHKCEFEKPTS 39
>YL613_MIMIV (Q5UP74) Hypothetical protein L613| Length = 386 Score = 30.0 bits (66), Expect = 5.7 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 4/103 (3%) Frame = -2 Query: 558 YSDAFALREKCATPILKQV---RSDVTRYRY-GDEQHLDEALKRIFQYGLGGGIPRRSAP 391 Y ++ EK P+++++ S +R+ D +L + R F G IPR Sbjct: 118 YQQIDSVGEKIYAPLVRKLFIGHSIWVSHRWISDSMNL---ITREFSIGFSKSIPRHHCE 174 Query: 390 ILQKIQEVTDDGKYCLVLEFEAKSLGLSDFEKRQNSPPFSVLG 262 + I+++ ++ +++E + L SD+EK N+ ++ G Sbjct: 175 TFESIRKLIENSCIPVIIETDYLDLEQSDYEKLINNQKRNIYG 217
>JPH3_MOUSE (Q9ET77) Junctophilin-3 (Junctophilin type 3) (JP-3)| Length = 744 Score = 29.3 bits (64), Expect = 9.7 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +2 Query: 293 LFSKSDSPNDLASNSSTKQYFPSSVTS*IFCNIGALRLGMPPPKPY*KIRFSASSR 460 L+ K +P+DL + S Q FP+S TS PPP P + + + SR Sbjct: 460 LYRKGTTPSDLTPDDSPLQSFPASPTS------------TPPPAPASRTKMAHFSR 503 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,565,336 Number of Sequences: 219361 Number of extensions: 1629527 Number of successful extensions: 4224 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4224 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)