| Clone Name | rbaal11f13 |
|---|---|
| Clone Library Name | barley_pub |
>GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 (EC| 1.1.3.15) (Glycolate oxidase 1) (GOX 1) (Short chain alpha-hydroxy acid oxidase 1) Length = 367 Score = 51.6 bits (122), Expect = 5e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -2 Query: 359 RMMREEFELTMALGGCTKLSDITREHIFTEGDRLGRPLPRM 237 +M+R+EFELTMAL GC LS+ITR HI TE D R LPR+ Sbjct: 328 QMLRDEFELTMALSGCRSLSEITRNHIVTEWD-TPRHLPRL 367
>GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 (EC| 1.1.3.15) (Glycolate oxidase 2) (GOX 2) (Short chain alpha-hydroxy acid oxidase 2) Length = 367 Score = 46.2 bits (108), Expect = 2e-05 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = -2 Query: 359 RMMREEFELTMALGGCTKLSDITREHIFTEGDRLGRPLPRM 237 +M+R+EFELTMAL GC L +I+R HI TE D RP R+ Sbjct: 328 QMLRDEFELTMALSGCRSLKEISRNHITTEWD-TPRPSARL 367
>GOX_SPIOL (P05414) Peroxisomal (S)-2-hydroxy-acid oxidase (EC 1.1.3.15)| (Glycolate oxidase) (GOX) (Short chain alpha-hydroxy acid oxidase) Length = 369 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 359 RMMREEFELTMALGGCTKLSDITREHIFTEGD 264 +MMR+EFELTMAL GC L +I+R HI + D Sbjct: 328 QMMRDEFELTMALSGCRSLKEISRSHIAADWD 359
>YWZ5_CAEEL (Q11095) Hypothetical protein C02B8.5| Length = 453 Score = 34.7 bits (78), Expect = 0.059 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 12 YVRTQ*DMXNTIWCSRCEIWWKWRDVPVDKY 104 Y R + N+ WC C + W+WR +P D Y Sbjct: 403 YRRGEALQTNSEWCGLCNLCWQWRKLPADYY 433
>MADCA_MOUSE (Q61826) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (mMAdCAM-1) Length = 405 Score = 31.6 bits (70), Expect = 0.50 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 267 RPPRTPAAEDVIKSQRNATHAIITANSISTTPSAP 163 +PP T +AE I + + A+ T +I+T PSAP Sbjct: 227 KPPNTTSAEPYILTSSSTAEAVSTGLNITTLPSAP 261
>PO3F2_HUMAN (P20265) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 443 Score = 30.8 bits (68), Expect = 0.85 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = -1 Query: 351 AGGVRA---HHGARRVHQAQRH-----HPRTHLHRGRPPRTP 250 AGG A HHG R H H HP +H H+ PP P Sbjct: 203 AGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPP 244
>PO3F2_RAT (P56222) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 445 Score = 30.8 bits (68), Expect = 0.85 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = -1 Query: 351 AGGVRA---HHGARRVHQAQRH-----HPRTHLHRGRPPRTP 250 AGG A HHG R H H HP +H H+ PP P Sbjct: 205 AGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPP 246
>PO3F2_MOUSE (P31360) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 445 Score = 30.8 bits (68), Expect = 0.85 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = -1 Query: 351 AGGVRA---HHGARRVHQAQRH-----HPRTHLHRGRPPRTP 250 AGG A HHG R H H HP +H H+ PP P Sbjct: 205 AGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPP 246
>KE4L_CAEEL (Q9XTQ7) Hypothetical Ke4-like protein H13N06.5 in chromosome X| Length = 462 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 360 AHDAGGVRAHHGARRVHQAQRHHPRTHLHRG 268 AHD G HHG + HH H H G Sbjct: 89 AHDHGHAHDHHGHSHDEEEDHHHGHAHDHHG 119
>FOXGB_HUMAN (P55315) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (HFK1) Length = 477 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 336 AHHGARRVHQAQRHHPRTHLHRGRPPRTP 250 A HG H Q HH H H PP P Sbjct: 35 ASHGHHNSHHPQHHHHHHHHHHHPPPPAP 63
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 336 AHHGARRVHQAQRHHPRTHLHRGRPPRTP 250 A HG H Q HH H H PP P Sbjct: 35 ASHGHHNSHHPQHHHHHHHHHHHPPPPAP 63
>XYNA_EMENI (P55332) Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8) (Xylanase| A) (1,4-beta-D-xylan xylanohydrolase A) (22 kDa xylanase) (Xylanase X22) Length = 225 Score = 28.9 bits (63), Expect = 3.2 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 10 YTCGPNRTWXIQYGVVGAKYGGNGETCRSTSTQKFIYYGSPSPAGHTRLA 159 YT G ++ +Q+ VG GG G ST T Y GS +P+G+ LA Sbjct: 63 YTNGAGGSYTVQWSNVGNFVGGKGWNPGSTRT--INYGGSFNPSGNGYLA 110
>CWC25_ASPFU (Q4X1D7) Pre-mRNA-splicing factor cwc25| Length = 447 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 339 RAHHGARRVHQAQRHHPRTHLHRGRPPRTPAAED 238 R+ H H++ RH R+H HR R P +P D Sbjct: 195 RSRHEDEDAHRSHRH--RSHRHRSRSPLSPDRSD 226
>RSC1_YEAST (P53236) Chromatin structure remodeling complex protein RSC1| (Remodel the structure of chromatin complex subunit 1) Length = 928 Score = 28.1 bits (61), Expect = 5.5 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 294 HPRTHLHRGRPP 259 HP+TH+ RGRPP Sbjct: 220 HPKTHVRRGRPP 231
>DSX_DROME (P23023) Protein doublesex| Length = 549 Score = 27.7 bits (60), Expect = 7.2 Identities = 19/77 (24%), Positives = 28/77 (36%), Gaps = 4/77 (5%) Frame = -1 Query: 351 AGGVRAHHGARRVHQAQRHHPRTHLHRGRPPRTPAAEDVIKSQRNATH----AIITANSI 184 A V H H HH H H P + PA + ++S ++ H T++S Sbjct: 197 AASVAQHQHQSHPHSHHHHHQNHHQH---PHQQPATQTALRSPPHSDHGGSVGPATSSSG 253 Query: 183 STTPSAPRC*PCVSGRG 133 PS+ S G Sbjct: 254 GGAPSSSNAAAATSSNG 270
>SELPA_BRARE (Q98SV1) Selenoprotein Pa precursor (zSelPa)| Length = 367 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = -1 Query: 357 HDAGGVRAHHGARRVHQAQRHHPRTHLHRGRPPRTPAAEDVIKSQ 223 H G H G H+ HHP H H R + + + SQ Sbjct: 206 HHEHGHHEHQGEAERHRHGHHHPHHHHHHHRGQQQVDVDQQVLSQ 250
>FOXGB_RAT (Q00939) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 480 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 336 AHHGARRVHQAQRHHPRTHLHRGRPP 259 A HG H Q HH H H PP Sbjct: 35 ASHGHHNSHHPQHHHHHHHHHHPPPP 60
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = -1 Query: 357 HDAGGVRAHHGARRVHQAQRHHPRTHLHRGRPPRTPAAE 241 H A AHH H P+ H H PP P E Sbjct: 997 HSAALPPAHHHPPHHHHHHAPPPQPHHHHAHPPHPPEME 1035
>SMUF2_HUMAN (Q9HAU4) Smad ubiquitination regulatory factor 2 (EC 6.3.2.-)| (Ubiquitin--protein ligase SMURF2) (Smad-specific E3 ubiquitin ligase 2) (hSMURF2) Length = 748 Score = 27.7 bits (60), Expect = 7.2 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = -1 Query: 324 ARRVHQAQRHH---PRTHLHRGRPPRTPAAEDVIKSQRNATHAIITANSIST--TPSAPR 160 A R ++QRH RTHLH PP P + +Q+ + + T +ST P PR Sbjct: 229 AERRVRSQRHRNYMSRTHLHT--PPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPR 286
>RL25_NITEU (Q82TQ5) 50S ribosomal protein L25 (General stress protein CTC)| Length = 198 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +1 Query: 1 R*VYTCGPNRTWXIQYGVVGAKYGGNGETCRSTSTQKFIYYGSPSPAGHTRLAS 162 R ++ G NR Q + G YGGNG+ K +YY A H + S Sbjct: 10 RKLHGTGANRRLRSQGRLPGVIYGGNGDAQSIELDHKDLYYKLKMEAFHASILS 63
>PPS1_YEAST (P38148) Dual specificity protein phosphatase PPS1 (EC 3.1.3.48)| (EC 3.1.3.16) Length = 807 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 7/56 (12%) Frame = -1 Query: 330 HGARRVHQ------AQRHHPRTH-LHRGRPPRTPAAEDVIKSQRNATHAIITANSI 184 H R+HQ ++ P H + G+PP P + ++KSQ +A ++ + NS+ Sbjct: 14 HDLMRLHQDAEWPECKKMFPWAHDISFGQPPDFPHSLAIVKSQSDANNSALLRNSL 69
>FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 481 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 Query: 336 AHHGARRVHQAQRHHPRTHLHRGRPP 259 A HG H Q HH H H PP Sbjct: 35 ASHGHHNSHHPQHHHHHHHHHHPPPP 60
>KLDC4_MOUSE (Q921I2) Kelch domain-containing protein 4| Length = 584 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 238 CDQEPTQRNARNNYSELYIYDAVSAKMLA 152 CD+E + + +S+LYIYDA ++ A Sbjct: 316 CDEEEEESLEGSFFSDLYIYDAAKSRWFA 344
>RHOC_MOUSE (Q62159) Rho-related GTP-binding protein RhoC precursor| (Silica-induced gene 61 protein) (SIG-61) Length = 193 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 59 VRNMVEMARRAGRQVRKN 112 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184
>RHOC_HUMAN (P08134) Rho-related GTP-binding protein RhoC precursor (H9)| Length = 193 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 59 VRNMVEMARRAGRQVRKN 112 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184
>DHOM_PSEAE (P29365) Homoserine dehydrogenase (EC 1.1.1.3) (HDH)| Length = 434 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 26 IGHGKYNMV*SVRNMVEMARRAGRQVRKNLSTTAHRPRP 142 +G G +N++ RN E+ARRAGR + + A RP P Sbjct: 14 VGGGTFNVL--ERNAEEIARRAGRGI-EVAQIAARRPNP 49
>KNOB_PLAFN (P06719) Knob-associated histidine-rich protein precursor (KAHRP)| Length = 657 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -1 Query: 330 HGARRVHQAQRHHPRTHLHRGRPPRT----PAAEDVIKSQ 223 HG + H HH HLH +P T P+ E V+K+Q Sbjct: 106 HGQDQAHHHHHHHHH-HLHPQQPQGTVANPPSNEPVVKTQ 144
>NR4A3_HUMAN (Q92570) Orphan nuclear receptor NR4A3 (Nuclear hormone receptor| NOR-1) (Neuron-derived orphan receptor 1) (Mitogen-induced nuclear orphan receptor) Length = 626 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = -1 Query: 333 HHGARRVHQAQRHHPRTHLHRGRPPRTPAAEDVIKSQRNATHAIITANSISTTPSAP 163 HH H HH + H PP + ++V+ S + + + S TTP+ P Sbjct: 95 HHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLPS--TSMYFKQSPPSTPTTPAFP 149
>MTCY_LEUME (P38577) Bacteriocin mesentericin Y105 precursor| Length = 61 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 52 VVGAKYGGNGETCRSTSTQKFIYYGSPSPAGHTRLAS 162 VVG KY GNG C T + + +G + AG RLA+ Sbjct: 21 VVGGKYYGNGVHC--TKSGCSVNWGEAASAGIHRLAN 55
>Y1173_MYCLE (P50474) Hypothetical protein ML1173| Length = 284 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 19 GPNRTWXIQYGVVGAKYGGNGETCRSTSTQKFIYYGSPSPAG 144 GP+ TW ++ G + YGG + C + G P P G Sbjct: 116 GPDDTW-LRLGAASSPYGGEIDDCSDIFDVRHWVDGEPVPLG 156
>NCBP2_ASHGO (Q754W7) Nuclear cap-binding protein subunit 2| Length = 218 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -1 Query: 345 GVRAHHGARRV---HQAQRHHPRTHLHRGRPPRTPAAE 241 G H GARR+ H+ HH H H P AA+ Sbjct: 164 GAVNHFGARRIRDPHKNHHHHHHGHHHHHGQPHAAAAK 201
>YCF68_SACOF (Q6ENQ5) Hypothetical 14 kDa protein ycf68 (ORF 134)| Length = 134 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 348 GGVRAHHGARRVHQAQRHHPRTHLHRGRPPRTP 250 G + H R V + H THLHR R R+P Sbjct: 65 GELSLEHRLRFVLNGKMEHLTTHLHRPRTTRSP 97
>YCF68_SACHY (Q6L3C9) Hypothetical 14 kDa protein ycf68 (ORF 134)| Length = 134 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 348 GGVRAHHGARRVHQAQRHHPRTHLHRGRPPRTP 250 G + H R V + H THLHR R R+P Sbjct: 65 GELSLEHRLRFVLNGKMEHLTTHLHRPRTTRSP 97
>YCF68_MAIZE (P03938) Hypothetical 14 kDa protein ycf68 (ORF 134)| Length = 134 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 348 GGVRAHHGARRVHQAQRHHPRTHLHRGRPPRTP 250 G + H R V + H THLHR R R+P Sbjct: 65 GELSLEHRLRFVLNGKMEHLTTHLHRPRTTRSP 97
>CUT_DROME (P10180) Homeobox protein cut| Length = 2175 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Frame = -1 Query: 360 AHDAGGVRAHHGARRVHQAQ-----RHHPRTHLHR 271 A DA AHH ++ HQ Q +HH + HLH+ Sbjct: 656 ASDALSEDAHHQQQQHHQQQHQHQQQHHQQQHLHQ 690
>PANX2_HUMAN (Q96RD6) Pannexin-2| Length = 633 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Frame = -1 Query: 261 PRTPA----AEDVIKSQRNATHAIITANSISTTP 172 P TPA AE + RNATH ++ N++S++P Sbjct: 592 PLTPASLGKAEPLTILSRNATHPLLHINTLSSSP 625
>KE4_BRARE (Q9PUB8) Zinc transporter Slc39a7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) (Fragment) Length = 352 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 7/35 (20%) Frame = -1 Query: 357 HDAGGVRAHHGARR-------VHQAQRHHPRTHLH 274 H GG + HHGA + H + HH H H Sbjct: 39 HSHGGAKMHHGASKWSAEANLPHAEEEHHVHDHGH 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,120,242 Number of Sequences: 219361 Number of extensions: 841547 Number of successful extensions: 2919 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 2730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2875 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)