>THYG_RAT (P06882) Thyroglobulin precursor|
          Length = 2768

 Score = 27.7 bits (60), Expect = 8.0
 Identities = 19/73 (26%), Positives = 26/73 (35%), Gaps = 19/73 (26%)
 Frame = +1

Query: 79   ELYRLWNCQEGDG-------------------ASRENLTCSEILPLSTSSLAPVASQYPG 201
            E Y  WN Q  DG                   ++  +L    +      S+ PV +QYP 
Sbjct: 783  EWYERWNTQNSDGQELTTATLLMKLMSYREVASTNFSLFLQSLYDAGQQSIFPVLAQYPS 842

Query: 202  LSCGPMVTCEVST 240
            L   P V  E +T
Sbjct: 843  LQDVPQVVLEGAT 855


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,068,841
Number of Sequences: 219361
Number of extensions: 487915
Number of successful extensions: 1315
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1315
length of database: 80,573,946
effective HSP length: 65
effective length of database: 66,315,481
effective search space used: 1591571544
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)