| Clone Name | rbaal11e19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_RTSVA (Q83034) Genome polyprotein [Contains: Putative leade... | 30 | 2.2 | 2 | POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leade... | 30 | 2.2 | 3 | LEPA_AGRT5 (Q8UIQ2) GTP-binding protein lepA | 29 | 3.7 | 4 | MURG_RICTY (Q68WW7) UDP-N-acetylglucosamine--N-acetylmuramyl-(pe... | 28 | 4.9 |
|---|
>POLG_RTSVA (Q83034) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3473 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 107 GVRCLHQKRMLGKSTLYRNYC 169 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 107 GVRCLHQKRMLGKSTLYRNYC 169 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>LEPA_AGRT5 (Q8UIQ2) GTP-binding protein lepA| Length = 608 Score = 28.9 bits (63), Expect = 3.7 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 82 LPPTYDXLWSSMPPPKTNVGKIHPLQKLL 168 +P + + + +PPPK++VG+ PL+ LL Sbjct: 178 IPDVLEAIVNRLPPPKSDVGENGPLKALL 206
>MURG_RICTY (Q68WW7) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 385 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = -2 Query: 230 VCSQSCPXRIWRTFI------FLTLEGNNFCRGWIFPTFVFGG 120 + SQ CP ++ +T + F+ N F IF F+FGG Sbjct: 172 LASQHCPTKLTKTVLTNTLNHFVKARNNKFSNCNIFTLFIFGG 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,051,743 Number of Sequences: 219361 Number of extensions: 681909 Number of successful extensions: 2094 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2094 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)