| Clone Name | rbaal6i04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VG50_SHV21 (Q01012) Probable transcription activator EDRF1 | 31 | 3.6 | 2 | PRKDC_XENLA (Q9DEI1) DNA-dependent protein kinase catalytic subu... | 30 | 7.9 |
|---|
>VG50_SHV21 (Q01012) Probable transcription activator EDRF1| Length = 535 Score = 30.8 bits (68), Expect = 3.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 379 PRGTPS**KFSPLNSCLPALYSRTTI---IYNVSCPTETPTMLSSLLCFSTN 525 PRG P K +C PAL+ + I +V CP PT+ + C S+N Sbjct: 406 PRGRPKGSKTKKRPTCSPALFQSSDIPTDSLHVKCPEMLPTVPQNEFCDSSN 457
>PRKDC_XENLA (Q9DEI1) DNA-dependent protein kinase catalytic subunit (EC| 2.7.11.1) (DNA-PK catalytic subunit) (DNA-PKcs) Length = 4146 Score = 29.6 bits (65), Expect = 7.9 Identities = 23/74 (31%), Positives = 36/74 (48%) Frame = +1 Query: 415 LNSCLPALYSRTTIIYNVSCPTETPTMLSSLLCFSTNTDLTFLRLRAK*SIPCLRFWYFR 594 + + +PAL +T +SCP L++L +STN L+ K IP L + Sbjct: 766 IKAYIPAL--QTAFKLGLSCPPLADVGLNALQYWSTNIPSDILKPYYKDIIPLLDGYLTN 823 Query: 595 VYSMSASASTLPIV 636 + S + S STL +V Sbjct: 824 LSSTNESLSTLDMV 837 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,571,761 Number of Sequences: 219361 Number of extensions: 1984938 Number of successful extensions: 3527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3526 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)