| Clone Name | rbaal10o18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POL_MMTVB (P03365) Pol polyprotein [Contains: Reverse transcript... | 31 | 4.1 | 2 | POL_MMTVC (P11283) Pol polyprotein [Contains: Reverse transcript... | 31 | 4.1 | 3 | K0196_MOUSE (Q8C2E7) Protein KIAA0196 | 30 | 7.0 |
|---|
>POL_MMTVB (P03365) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 899 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 537 NSWPLSAQSIARLKSLPVTGTLLLG-LESSNCPW 635 N WPL + + L+ L VT L LG LE SN PW Sbjct: 29 NQWPLKQEKLQALQQL-VTEQLQLGHLEESNSPW 61
>POL_MMTVC (P11283) Pol polyprotein [Contains: Reverse transcriptase (EC| 2.7.7.49); Endonuclease] (Fragment) Length = 114 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 537 NSWPLSAQSIARLKSLPVTGTLLLG-LESSNCPW 635 N WPL + + L+ L VT L LG LE SN PW Sbjct: 29 NQWPLKQEKLQALQQL-VTEQLQLGHLEESNSPW 61
>K0196_MOUSE (Q8C2E7) Protein KIAA0196| Length = 1159 Score = 30.0 bits (66), Expect = 7.0 Identities = 21/57 (36%), Positives = 29/57 (50%) Frame = -2 Query: 234 TRSFMRGLIRTAVINIHMEIVRTVDISVLQTYEDHHAIAIWLVADKLTSIQTESINI 64 TR F+ +IRT INI E++ TV I ++ W + D TSI ESI + Sbjct: 527 TRKFLHQMIRT--INIKEEVLITVQIIGDLSFA-------WQLIDSFTSIMQESIRV 574 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,114,668 Number of Sequences: 219361 Number of extensions: 1847409 Number of successful extensions: 4443 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4443 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)