| Clone Name | rbaal11d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CO7A1_HUMAN (Q02388) Collagen alpha-1(VII) chain precursor (Long... | 30 | 7.7 |
|---|
>CO7A1_HUMAN (Q02388) Collagen alpha-1(VII) chain precursor (Long-chain| collagen) (LC collagen) Length = 2944 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 316 REKYGLDTSQFTYNPSDATRYQQNGAPPAEE 224 R + GL+ Q PSD TRYQ +G P E Sbjct: 449 RRETGLEPPQKVVLPSDVTRYQLDGLQPGTE 479 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,113,116 Number of Sequences: 219361 Number of extensions: 2020775 Number of successful extensions: 4886 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4885 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)