| Clone Name | rbaal11c18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PGP2_SULSO (P95931) Phosphoglycolate phosphatase 2 (EC 3.1.3.18)... | 30 | 7.9 |
|---|
>PGP2_SULSO (P95931) Phosphoglycolate phosphatase 2 (EC 3.1.3.18) (PGPase 2)| (PGP 2) Length = 233 Score = 29.6 bits (65), Expect = 7.9 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = -1 Query: 581 SPALTQQEQEMLRDVKYRKFVPGISKSQEF-DTKARHMKQSRLIKSNSHSPSSGNRKEFL 405 SP ++Q+ E + KY KFV + ++F D A +K + I N +R+ L Sbjct: 28 SPIVSQKVNEFSK--KY-KFVVVTGREKKFIDKLAVGLKPTAWILENGSLILFNDREFVL 84 Query: 404 SIRSLLPVIDFEIDRTKALDMIDNLKVQ 321 +S FE DR K ++++DNLKV+ Sbjct: 85 CEKSW-----FERDRKKIIEILDNLKVR 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,915,165 Number of Sequences: 219361 Number of extensions: 1914655 Number of successful extensions: 5202 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5200 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)