| Clone Name | rbaal10m23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MT21_ORYSA (P94029) Metallothionein-like protein type 2 | 36 | 0.059 | 2 | SOX14_DROME (P40656) Putative transcription factor SOX-14 | 30 | 5.5 | 3 | COX3_LEITA (P14546) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) ... | 29 | 7.2 |
|---|
>MT21_ORYSA (P94029) Metallothionein-like protein type 2| Length = 82 Score = 36.2 bits (82), Expect = 0.059 Identities = 20/38 (52%), Positives = 24/38 (63%) Frame = -1 Query: 448 MYPGMDEGVSTTATSSQALVMGVASSKGNGPSFEAAAA 335 MYP M E V+TT Q ++MGVA SKG+ EA AA Sbjct: 25 MYPEMAEEVTTT----QTVIMGVAPSKGHAEGLEAGAA 58
>SOX14_DROME (P40656) Putative transcription factor SOX-14| Length = 472 Score = 29.6 bits (65), Expect = 5.5 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = +3 Query: 249 PSPCVDSTDHLQVHGLQVQLGPHLHPPFSAAAASNEGPLPLEDATPMTRAWEEVAVVLTP 428 P+P DST PH PPFS + + P P TP + + A + P Sbjct: 42 PAPKADST-------------PHTLPPFSPSPSPASSPSPAPAQTPGAQKTQSQAAITHP 88 Query: 429 SSI 437 +++ Sbjct: 89 AAV 91
>COX3_LEITA (P14546) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) Length = 284 Score = 29.3 bits (64), Expect = 7.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -1 Query: 184 IASVCFVFNCHLLE*DGIYRIVIVSS*STDYVYVPLVACTVFCVVLXMC 38 + ++C V+ L G++ I+ S DY ++ AC +FC+V +C Sbjct: 16 LPAICIVYLTFCL--CGLFCIMFGSFIFIDYCFICFFACLLFCLVCLLC 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,652,694 Number of Sequences: 219361 Number of extensions: 953927 Number of successful extensions: 2656 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2655 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)