| Clone Name | rbaal11b14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SEM11_ARATH (Q9XIR8) Probable 26 proteasome complex subunit sem1-1 | 44 | 3e-04 | 2 | SEM12_ARATH (Q9FL96) Probable 26 proteasome complex subunit sem1-2 | 38 | 0.012 |
|---|
>SEM11_ARATH (Q9XIR8) Probable 26 proteasome complex subunit sem1-1| Length = 74 Score = 43.5 bits (101), Expect = 3e-04 Identities = 22/46 (47%), Positives = 27/46 (58%) Frame = -1 Query: 304 INQEWDDKEDGNEAVQQWEXXXXXXXXXXDFSLQLRKELEGGNTQK 167 IN++W +KE+ E QQWE DFS QLRKELE G +K Sbjct: 29 INEDWLEKEEVKEVSQQWEDDWDDDDVNDDFSRQLRKELENGTDKK 74
>SEM12_ARATH (Q9FL96) Probable 26 proteasome complex subunit sem1-2| Length = 73 Score = 38.1 bits (87), Expect = 0.012 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = -1 Query: 304 INQEWDDKEDGNEAVQQWEXXXXXXXXXXDFSLQLRKELEGGNTQK 167 IN++W +KE+ E QWE DFS QL+KELE + +K Sbjct: 28 INEDWLEKEEVKEVSLQWEDDWDDDDVSDDFSRQLKKELENASEKK 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,859,747 Number of Sequences: 219361 Number of extensions: 626147 Number of successful extensions: 1138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)