| Clone Name | rbaal11a23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TA2R5_PANTR (Q646A4) Taste receptor type 2 member 5 (T2R5) | 31 | 4.1 | 2 | TA2R5_PANPA (Q646D5) Taste receptor type 2 member 5 (T2R5) | 31 | 4.1 | 3 | TA2R5_PAPHA (Q646E6) Taste receptor type 2 member 5 (T2R5) | 30 | 9.1 | 4 | TA2R5_HUMAN (Q9NYW4) Taste receptor type 2 member 5 (T2R5) | 30 | 9.1 | 5 | TA2R5_GORGO (Q645Z1) Taste receptor type 2 member 5 (T2R5) | 30 | 9.1 |
|---|
>TA2R5_PANTR (Q646A4) Taste receptor type 2 member 5 (T2R5)| Length = 299 Score = 30.8 bits (68), Expect = 4.1 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 17/95 (17%) Frame = -1 Query: 514 REW-----FSCSNVILVGSVTGCRFVLAW*ALAFGARHLVVCSEKDYLAVLALGWLVS*N 350 REW +S N+I++G + GCRFVL W + + +L L++ W++ Sbjct: 33 REWIRKFSWSSYNLIILG-LAGCRFVLQW-LIILDLSLFPLFQSSRWLRYLSIFWVLVSQ 90 Query: 349 LDHWFIFWI---FCPK---------TWSQSTSYSL 281 WF ++ +C K W + +Y+L Sbjct: 91 ASLWFATFLSVFYCKKITTFDHPAYLWLKQRAYNL 125
>TA2R5_PANPA (Q646D5) Taste receptor type 2 member 5 (T2R5)| Length = 299 Score = 30.8 bits (68), Expect = 4.1 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 17/95 (17%) Frame = -1 Query: 514 REW-----FSCSNVILVGSVTGCRFVLAW*ALAFGARHLVVCSEKDYLAVLALGWLVS*N 350 REW +S N+I++G + GCRFVL W + + +L L++ W++ Sbjct: 33 REWIRKFSWSSYNLIILG-LAGCRFVLQW-LIILDLSLFPLFQSSRWLRYLSIFWVLVSQ 90 Query: 349 LDHWFIFWI---FCPK---------TWSQSTSYSL 281 WF ++ +C K W + +Y+L Sbjct: 91 ASLWFATFLSVFYCKKITTFDHPAYLWLKQRAYNL 125
>TA2R5_PAPHA (Q646E6) Taste receptor type 2 member 5 (T2R5)| Length = 299 Score = 29.6 bits (65), Expect = 9.1 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 17/96 (17%) Frame = -1 Query: 517 IREW-----FSCSNVILVGSVTGCRFVLAW*ALAFGARHLVVCSEKDYLAVLALGWLVS* 353 +REW +S N+I++G + GCRF+L W + + +L L + W++ Sbjct: 32 LREWIRKFSWSSYNLIILG-LAGCRFLLQW-LIILDLSLFPLFQSSSWLRYLNVFWVLVS 89 Query: 352 NLDHWFIFWI---FCPK---------TWSQSTSYSL 281 WF ++ +C K W + +Y+L Sbjct: 90 QASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNL 125
>TA2R5_HUMAN (Q9NYW4) Taste receptor type 2 member 5 (T2R5)| Length = 299 Score = 29.6 bits (65), Expect = 9.1 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 17/95 (17%) Frame = -1 Query: 514 REW-----FSCSNVILVGSVTGCRFVLAW*ALAFGARHLVVCSEKDYLAVLALGWLVS*N 350 REW +S N+I++G + GCRF+L W + + +L L++ W++ Sbjct: 33 REWIRKFNWSSYNLIILG-LAGCRFLLQW-LIILDLSLFPLFQSSRWLRYLSIFWVLVSQ 90 Query: 349 LDHWFIFWI---FCPK---------TWSQSTSYSL 281 WF ++ +C K W + +Y+L Sbjct: 91 ASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNL 125
>TA2R5_GORGO (Q645Z1) Taste receptor type 2 member 5 (T2R5)| Length = 299 Score = 29.6 bits (65), Expect = 9.1 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 17/95 (17%) Frame = -1 Query: 514 REW-----FSCSNVILVGSVTGCRFVLAW*ALAFGARHLVVCSEKDYLAVLALGWLVS*N 350 REW +S N+I++G + GCRF+L W + + +L L++ W++ Sbjct: 33 REWMRKFNWSSYNLIILG-LAGCRFLLQW-LIILDLSLFPLFQSSRWLRYLSIFWVLVSQ 90 Query: 349 LDHWFIFWI---FCPK---------TWSQSTSYSL 281 WF ++ +C K W + +Y+L Sbjct: 91 ASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNL 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,107,674 Number of Sequences: 219361 Number of extensions: 2319091 Number of successful extensions: 5382 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5381 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)