| Clone Name | rbaal10k14 |
|---|---|
| Clone Library Name | barley_pub |
>VIRAL_AGRTU (P07167) Limited host range virA protein (EC 2.7.13.3) (LHR virA)| Length = 835 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = +3 Query: 147 KVGTCYKDSSRSKQASKQRHSTSLG---NLFDAGR 242 K+G C++DS+ +KQ+ K +LG N F+A + Sbjct: 300 KIGVCFEDSTETKQSLKSSAEAALGTIENFFEANQ 334
>SELI_HUMAN (Q9C0D9) Selenoprotein I| Length = 397 Score = 29.6 bits (65), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 168 DSSRSKQASKQRHSTSLGNLFDAGRRLDSW 257 D KQA + ST LG LFD G LDSW Sbjct: 104 DGVDGKQARRTNSSTPLGELFDHG--LDSW 131
>DNAK_PSEHT (Q3IC08) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 638 Score = 29.6 bits (65), Expect = 4.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 187 KQASRGTPLLSVTYLMQADGLIH 255 + A RGTP + VT+ + ADG++H Sbjct: 463 RPAQRGTPQIEVTFDVDADGILH 485
>SELI_MOUSE (Q80TA1) Selenoprotein I| Length = 398 Score = 29.6 bits (65), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 168 DSSRSKQASKQRHSTSLGNLFDAGRRLDSW 257 D KQA + ST LG LFD G LDSW Sbjct: 104 DGVDGKQARRTNSSTPLGELFDHG--LDSW 131
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 29.3 bits (64), Expect = 5.6 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = -2 Query: 133 PCPCACNCVKLCCY--LLAACRYWPGCCVSFVLECK 32 PC C+ C CC C CCV +CK Sbjct: 202 PCCCSSGCGSSCCQSSCCKPCSSQSSCCVPICCQCK 237
>DNAK2_COLP3 (Q47XI6) Chaperone protein dnaK 2 (Heat shock protein 70 2) (Heat| shock 70 kDa protein 2) (HSP70 2) Length = 638 Score = 29.3 bits (64), Expect = 5.6 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 193 ASRGTPLLSVTYLMQADGLIH 255 A RGTP + VT+ + ADG++H Sbjct: 465 AQRGTPQIEVTFDIDADGILH 485
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = -2 Query: 133 PCPCACNCVKLCCY--LLAACRYWPGCCVSFVLECK 32 PC C+ C CC C CCV +CK Sbjct: 93 PCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCK 128
>SELI_PONPY (Q5NV96) Selenoprotein I| Length = 397 Score = 28.5 bits (62), Expect = 9.6 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 168 DSSRSKQASKQRHSTSLGNLFDAGRRLDSW 257 D KQA + ST LG LFD G LD+W Sbjct: 104 DGVDGKQARRTNSSTPLGELFDHG--LDNW 131
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = -2 Query: 133 PCPCACNCVKLCCY--LLAACRYWPGCCVSFVLECK 32 PC C+ C CC C CCV +CK Sbjct: 151 PCCCSSGCGSSCCQSSCCKPCCSQSSCCVPICCQCK 186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,497,297 Number of Sequences: 219361 Number of extensions: 624865 Number of successful extensions: 2051 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2035 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)