| Clone Name | rbaal6h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IL21R_HUMAN (Q9HBE5) Interleukin-21 receptor precursor (IL-21R) ... | 29 | 3.4 | 2 | DDX28_MACFA (Q4R4T6) Probable ATP-dependent RNA helicase DDX28 (... | 28 | 5.8 | 3 | RDGC_HAEIN (P44628) Recombination-associated protein rdgC | 27 | 10.0 |
|---|
>IL21R_HUMAN (Q9HBE5) Interleukin-21 receptor precursor (IL-21R) (Novel| interleukin receptor) Length = 538 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 166 GGWSCPLKNCLMN*KVETSCLVHVPNQHCNALTHVW 59 GGW CP C + C++ + N H + LT W Sbjct: 16 GGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTW 51
>DDX28_MACFA (Q4R4T6) Probable ATP-dependent RNA helicase DDX28 (EC 3.6.1.-)| (Mitochondrial DEAD box protein 28) Length = 546 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +2 Query: 35 SINQHRRMPHMSQRIAMLIWHMNKTRCFYFLVH*TILQRTAPSSIIT*FCTT 190 S N H MPH+ Q L + L H +RT PS + FC + Sbjct: 355 SSNLHCIMPHVKQTFLRLKGADKVAELVHILKHHNRAERTGPSGTVLVFCNS 406
>RDGC_HAEIN (P44628) Recombination-associated protein rdgC| Length = 302 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 199 FNPCGTELCDDGGWSCPLK 143 F+PCGT+ GWS PL+ Sbjct: 31 FHPCGTQDQSKFGWSAPLR 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,940,872 Number of Sequences: 219361 Number of extensions: 650449 Number of successful extensions: 1326 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1326 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)