| Clone Name | rbaal10i23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y656_PYRAB (Q9V0Y3) UPF0189 protein PYRAB06560 | 30 | 1.3 | 2 | Y1536_PYRFU (Q8U0P9) UPF0189 protein PF1536 | 30 | 2.2 | 3 | CRE1_NEUCR (O59958) DNA-binding protein cre-1 (Carbon catabolite... | 29 | 3.7 | 4 | YDJE_ECOLI (P38055) Inner membrane metabolite transport protein ... | 28 | 8.3 |
|---|
>Y656_PYRAB (Q9V0Y3) UPF0189 protein PYRAB06560| Length = 186 Score = 30.4 bits (67), Expect = 1.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 40 VSPPTXXXKRPIPFLIYIIGPRCFHKWQKSSK 135 V+PP K + ++I+ +GP C KW + + Sbjct: 73 VTPPLNLAKNGVKYVIHTVGPYCGGKWDEDKR 104
>Y1536_PYRFU (Q8U0P9) UPF0189 protein PF1536| Length = 183 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 40 VSPPTXXXKRPIPFLIYIIGPRCFHKWQKSSKYTAK 147 V+PP K + ++I+ +GP C W + K K Sbjct: 70 VTPPLQLEKNGVKYVIHTVGPYCGGSWDEDKKSKLK 105
>CRE1_NEUCR (O59958) DNA-binding protein cre-1 (Carbon catabolite repressor)| Length = 430 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/60 (25%), Positives = 25/60 (41%) Frame = +3 Query: 21 HPTTGSRFSSNGXKXTPHPVSHLHNRTPMFP*MAEIKQVYSKRNSFSTTPQXNRPHAFFP 200 H SR + G + HP+ H H P K + S + ++P + PH++ P Sbjct: 130 HSNPNSRRGNKGQQQQQHPLVHNHGLQPDMMPPPGPKAIRSAPPTAMSSPNVSPPHSYSP 189
>YDJE_ECOLI (P38055) Inner membrane metabolite transport protein ydjE| Length = 452 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 187 WGRFXWGVVLNEFLLLYTCLISAIY 113 W +G+V+ FL +Y C SA+Y Sbjct: 350 WAILIYGLVMIFFLYMYVCFASAVY 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,234,265 Number of Sequences: 219361 Number of extensions: 642508 Number of successful extensions: 1338 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1338 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)