ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal10h18 |
|---|---|
| Clone Library Name | barley_pub |
>VSR3_ARATH (O80977) Vacuolar sorting receptor 3 precursor (AtVSR3) (Epidermal| growth factor receptor-like protein 2a) (AtELP2a) (BP80-like protein a') (AtBP80a') Length = 628 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 351 YAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIHSH 247 Y VYKYR+R+YMDSEIRAIMAQYMPL++Q +I +H Sbjct: 588 YLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIPNH 622
>VSR1_ARATH (P93026) Vacuolar sorting receptor 1 precursor (AtVSR1) (Epidermal| growth factor receptor-like protein 1) (AtELP1) (AtELP) (BP80-like protein b) (AtBP80b) (Spot 3 protein) Length = 623 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 360 IAGYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 265 ++GYAVYKYRIR YMD+EIR IMAQYMPLE+Q Sbjct: 581 LSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ 612
>VSR4_ARATH (Q56ZQ3) Vacuolar sorting receptor 4 precursor (AtVSR4) (Epidermal| growth factor receptor-like protein 2b) (AtELP2b) (BP80-like protein a) (AtBP80a) Length = 628 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 351 YAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIHSH 247 Y VYKYR+R+YMDSEIRAIMAQYMPL++Q ++ +H Sbjct: 588 YLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVPNH 622
>VSR1_PEA (P93484) Vacuolar sorting receptor 1 precursor (BP-80) (80 kDa| proaleurein-binding protein) Length = 623 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 354 GYAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIHSH 247 G+ VYKYRIR+YMDSEIRAIMAQYMPL++Q + +H Sbjct: 582 GFLVYKYRIRQYMDSEIRAIMAQYMPLDSQEEGPNH 617
>VSR2_ARATH (O22925) Vacuolar sorting receptor 2 precursor (AtVSR2) (Epidermal| growth factor receptor-like protein 4) (AtELP4) (BP80-like protein c) (AtBP80c) Length = 625 Score = 56.2 bits (134), Expect = 2e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 360 IAGYAVYKYRIRRYMDSEIRAIMAQYMPLEN 268 + Y VYKYRIR YMDSEIRAIMAQYMPL+N Sbjct: 583 LGAYTVYKYRIRTYMDSEIRAIMAQYMPLDN 613
>VSR6_ARATH (Q9FYH7) Vacuolar sorting receptor 6 precursor (AtVSR6) (Epidermal| growth factor receptor-like protein 6) (AtELP6) (BP80-like protein d) (AtBP80d) Length = 622 Score = 53.9 bits (128), Expect = 9e-08 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 360 IAGYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 265 + GY YKYR+R YMDSEI AIM+QYMPLE+Q Sbjct: 570 VGGYVFYKYRLRSYMDSEIMAIMSQYMPLESQ 601
>VSR7_ARATH (Q8L7E3) Vacuolar sorting receptor 7 precursor (AtVSR7) (Epidermal| growth factor receptor-like protein 3) (AtELP3) (BP80-like protein f) (AtBP80f) Length = 625 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 360 IAGYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 265 +AGY YKYR R YMDSEI IM+QYMPLE+Q Sbjct: 580 LAGYIFYKYRFRSYMDSEIMTIMSQYMPLESQ 611
>VSR5_ARATH (O64758) Vacuolar sorting receptor 5 precursor (AtVSR5) (Epidermal| growth factor receptor-like protein 5) (AtELP5) (BP80-like protein e) (AtBP80e) Length = 618 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -2 Query: 360 IAGYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 265 + Y YKY ++ YMDSEI +IM+QY+PL++Q Sbjct: 579 LGAYIFYKYHLQSYMDSEIVSIMSQYIPLDSQ 610
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 255 HSHPHQIEM*RATPHSPVYGTNIFRS 178 H HPHQI PHS +G + RS Sbjct: 229 HPHPHQIPHPHPQPHSQPHGHRLLRS 254
>MRAW_THETN (Q8R9F9) S-adenosyl-methyltransferase mraW (EC 2.1.1.-)| Length = 308 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 192 SFHKLENAALLFTSQSGEDDCECLPGSPGAC 284 +FH LE+ + T + E+ C C PG P C Sbjct: 240 TFHSLEDRIVKNTFKKLENPCTCPPGLPCTC 270
>GLI3_XENLA (Q91660) Zinc finger protein GLI3 (Neural-specific DNA-binding| protein xGLI3) (xGLI-3) Length = 1569 Score = 28.1 bits (61), Expect = 5.5 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 337 VSDPEVHGFRDPRHHGAVHA----PGEPGRHSQSSSP 239 V PE H + R G +H P EPG HSQS SP Sbjct: 636 VHGPEAHVTKKQR--GDIHPRPPPPREPGSHSQSRSP 670
>ATG9A_RAT (Q5FWU3) Autophagy-related protein 9A (APG9-like 1)| Length = 839 Score = 28.1 bits (61), Expect = 5.5 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -2 Query: 306 IRAIMAQ--YMPLENQGDIHSHPHQIEM*RATPHSPVYGTNIFRSACVIVAILLYSILRP 133 +R I+A YMP QG+ H + E + + V+ S V IL++ + Sbjct: 438 LRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLRPR 497 Query: 132 FCKFLDY*SPKSARRQNYGDTASRAEMFVPGH 37 + +D+ + GDT S A+M V H Sbjct: 498 ALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQH 529
>ATG9A_PONPY (Q5RCS0) Autophagy-related protein 9A (APG9-like 1)| Length = 839 Score = 28.1 bits (61), Expect = 5.5 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -2 Query: 306 IRAIMAQ--YMPLENQGDIHSHPHQIEM*RATPHSPVYGTNIFRSACVIVAILLYSILRP 133 +R I+A YMP QG+ H + E + + V+ S V IL++ + Sbjct: 438 LRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLRPR 497 Query: 132 FCKFLDY*SPKSARRQNYGDTASRAEMFVPGH 37 + +D+ + GDT S A+M V H Sbjct: 498 ALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQH 529
>ATG9A_HUMAN (Q7Z3C6) Autophagy-related protein 9A (APG9-like 1)| Length = 839 Score = 28.1 bits (61), Expect = 5.5 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -2 Query: 306 IRAIMAQ--YMPLENQGDIHSHPHQIEM*RATPHSPVYGTNIFRSACVIVAILLYSILRP 133 +R I+A YMP QG+ H + E + + V+ S V IL++ + Sbjct: 438 LRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLRPR 497 Query: 132 FCKFLDY*SPKSARRQNYGDTASRAEMFVPGH 37 + +D+ + GDT S A+M V H Sbjct: 498 ALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQH 529
>ATG9A_BOVIN (Q3T904) Autophagy-related protein 9A (APG9-like 1) (Autophagy| protein 9) Length = 839 Score = 28.1 bits (61), Expect = 5.5 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -2 Query: 306 IRAIMAQ--YMPLENQGDIHSHPHQIEM*RATPHSPVYGTNIFRSACVIVAILLYSILRP 133 +R I+A YMP QG+ H + E + + V+ S V IL++ + Sbjct: 438 LRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLRPR 497 Query: 132 FCKFLDY*SPKSARRQNYGDTASRAEMFVPGH 37 + +D+ + GDT S A+M V H Sbjct: 498 ALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQH 529
>C1QT5_RAT (Q5FVH0) Complement C1q tumor necrosis factor-related protein 5| precursor Length = 243 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 361 DRRIRSVQVSDPEVHGFRDPRHHGAVHAPGEPGRHSQSSSP 239 D +I S+ P + G P HHG+ PG GR + +P Sbjct: 21 DNKIPSLCPGQPGLPG--TPGHHGSQGLPGRDGRDGRDGAP 59
>C1QT5_MOUSE (Q8K479) Complement C1q tumor necrosis factor-related protein 5| precursor Length = 243 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 361 DRRIRSVQVSDPEVHGFRDPRHHGAVHAPGEPGRHSQSSSP 239 D +I S+ P + G P HHG+ PG GR + +P Sbjct: 21 DNKIPSLCPGQPGLPG--TPGHHGSQGLPGRDGRDGRDGAP 59
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 334 SDPEVHGFRDPRHHGAVHAPGEPGRHSQSSSP 239 +D E + R RHH + H + GRH +S P Sbjct: 18 TDRETNHSRRHRHHHSRHRESKHGRHDRSERP 49
>HIF1A_ONCMY (Q98SW2) Hypoxia-inducible factor 1 alpha (HIF-1 alpha) (HIF1| alpha) Length = 766 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 127 TERS*YAVQ*DRYNHTCRTKNVRSINWRMRRCSSHLNL 240 TERS + + RT NV+S W++ CS H+ + Sbjct: 165 TERSFFLRMKCTLTNRGRTVNVKSATWKVLHCSDHVRV 202
>C1QT5_HUMAN (Q9BXJ0) Complement C1q tumor necrosis factor-related protein 5| precursor Length = 243 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 361 DRRIRSVQVSDPEVHGFRDPRHHGAVHAPGEPGRHSQSSSP 239 D +I S+ P + G P HHG+ PG GR + +P Sbjct: 21 DNKIPSLCPGHPGLPG--TPGHHGSQGLPGRDGRDGRDGAP 59
>CAC1D_RAT (P27732) Voltage-dependent L-type calcium channel alpha-1D subunit| (Voltage-gated calcium channel alpha subunit Cav1.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 2) (RAT brain class D) (RBD) Length = 2203 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 361 DRRIRSVQVSDPEVHG-FRDPRHHG 290 D ++ ++ DPE+HG FRDPR G Sbjct: 1859 DEQLPTIFREDPEIHGYFRDPRCFG 1883
>NOTC1_RAT (Q07008) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 252 CECLPGSPGA-CTAP*WRGSLNPCTSGSDTCT 344 C+CLPG GA C + NPC +G++ CT Sbjct: 931 CDCLPGFQGAFCEEDINECATNPCQNGAN-CT 961
>NPHP3_XENLA (Q6AZT7) Nephrocystin-3| Length = 1300 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +3 Query: 111 NNLEIYRTVLVCCTIRSLQSHMPNEKCSFHKLENAALLFTSQSGEDDCECLPGSPG 278 + + +YR VL RS+Q MP+ K E + S +G +CE + PG Sbjct: 715 DTVSLYRLVL-----RSVQEVMPSAKEKEFMREILCFISVSHNGVSECELMELCPG 765 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,823,389 Number of Sequences: 219361 Number of extensions: 1164876 Number of successful extensions: 3511 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 3355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3511 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
