| Clone Name | rbaal10h15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXOC1_DROME (Q9VVG4) Probable exocyst complex component 1 (Exocy... | 30 | 1.6 | 2 | UNG_ACIAD (Q6F9Y2) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 28 | 5.9 |
|---|
>EXOC1_DROME (Q9VVG4) Probable exocyst complex component 1 (Exocyst complex| component Sec3) Length = 889 Score = 30.0 bits (66), Expect = 1.6 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +2 Query: 32 VVYPTTKQTYTPLTAVKVLIVLQSIEHDRADEQPSXDGREQRSXDR 169 V+ PTTK T T L K + + QSI PS DG Q+ DR Sbjct: 528 VISPTTKNTQTTLEMEKAVDMTQSIISGAV--SPSGDGVPQKRIDR 571
>UNG_ACIAD (Q6F9Y2) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 237 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 5/32 (15%) Frame = +2 Query: 32 VVYPTTKQTY-----TPLTAVKVLIVLQSIEH 112 V+YP +KQ + TPL+AVKV+I+ Q H Sbjct: 49 VIYPPSKQIFNALNTTPLSAVKVVILGQDPYH 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,897,480 Number of Sequences: 219361 Number of extensions: 368471 Number of successful extensions: 790 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)