| Clone Name | rbaal10h13 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 62.4 bits (150), Expect = 3e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQA 96 AYVRIIGFD MRQVQCVSFIAFKPPG EE G+A Sbjct: 81 AYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 61.2 bits (147), Expect = 7e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQA 96 AYVRIIGFD MRQVQCVSFIAFKPPG +E G+A Sbjct: 142 AYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 60.8 bits (146), Expect = 9e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQA 96 AYVR+IGFD MRQVQCVSFIAF+PPG EE G+A Sbjct: 143 AYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQA 96 AYVR+IGFD +RQVQCVSFIAF+PPG EE G+A Sbjct: 142 AYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 52.0 bits (123), Expect = 4e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD RQVQCVSFIAFKPPG+ Sbjct: 154 AFIRIIGFDNKRQVQCVSFIAFKPPGY 180
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KPPGF Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPPGF 180
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 52.0 bits (123), Expect = 4e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQA 96 Y RIIGFD MRQVQ VSFIA KPPG EE G+A Sbjct: 144 YCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 52.0 bits (123), Expect = 4e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXG 102 A+VRIIGFD +RQVQ +SFIA+KPPG EE G Sbjct: 143 AFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 51.6 bits (122), Expect = 6e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXG 102 A++RIIGFD +RQVQ +SFIA+KPPG EE G Sbjct: 143 AFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 50.8 bits (120), Expect = 1e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGF 114 ++RIIGFD +RQVQC+SFIA+KPPGF Sbjct: 153 FIRIIGFDNVRQVQCISFIAYKPPGF 178
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 50.8 bits (120), Expect = 1e-06 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KPPG+ Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPPGY 180
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 50.8 bits (120), Expect = 1e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEE 108 A++RIIGFD RQVQC+SFIA+KPP F E Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTE 180
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 50.8 bits (120), Expect = 1e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEE 108 A++RIIGFD RQVQC+SFIA+KPP F E Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTE 180
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 50.1 bits (118), Expect = 2e-06 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KPP F Sbjct: 152 AFIRIIGFDNVRQVQCISFIAYKPPSF 178
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEE 108 A++RIIGFD RQVQC+SFIA+KPP F + Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTD 180
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEE 108 A++RIIGFD RQVQC+SFIA+KPP F + Sbjct: 53 AFIRIIGFDNNRQVQCISFIAYKPPSFTD 81
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD RQVQC+SFIA+KPP F Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSF 178
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 49.3 bits (116), Expect = 3e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA+KP GF Sbjct: 155 AWVRIIGFDNVRQVQCISFIAYKPEGF 181
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 48.9 bits (115), Expect = 4e-06 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD RQVQC+SFIA+KPP F Sbjct: 152 AFIRIIGFDNNRQVQCISFIAYKPPSF 178
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 48.9 bits (115), Expect = 4e-06 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD RQVQC+SFIA+KPP F Sbjct: 152 AFIRIIGFDNNRQVQCISFIAYKPPSF 178
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 48.5 bits (114), Expect = 5e-06 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGF 114 ++RIIGFD +RQVQC+SFIA+KPP F Sbjct: 153 FIRIIGFDNVRQVQCISFIAYKPPSF 178
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 48.5 bits (114), Expect = 5e-06 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGF 114 ++RIIGFD +RQVQC+SFIA+KPP F Sbjct: 153 FIRIIGFDNVRQVQCISFIAYKPPSF 178
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 +++RIIGFD +RQVQC+SFIA+KP GF Sbjct: 157 SFIRIIGFDNVRQVQCISFIAYKPAGF 183
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 +++RIIGFD +RQVQC+SFIA+KP GF Sbjct: 157 SFIRIIGFDNVRQVQCISFIAYKPAGF 183
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 48.1 bits (113), Expect = 6e-06 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEGY 180
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 48.1 bits (113), Expect = 6e-06 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEGY 180
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 48.1 bits (113), Expect = 6e-06 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEGY 180
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 48.1 bits (113), Expect = 6e-06 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWVRIIGFDNVRQVQCISFIAYKPEGY 180
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPG 117 Y RIIGFD +RQVQC+SF+A+KPPG Sbjct: 157 YARIIGFDNVRQVQCISFLAYKPPG 181
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 48.1 bits (113), Expect = 6e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 156 AFIRIIGFDNVRQVQCISFIAYKPKGY 182
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEGY 180
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEGY 180
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEGY 180
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEGY 180
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD RQVQCVSFIA+KP G+ Sbjct: 154 AFIRIIGFDSNRQVQCVSFIAYKPAGY 180
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKPEGY 180
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 47.8 bits (112), Expect = 8e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEE 108 A +RIIGFD RQVQC+SFIA+KPP F + Sbjct: 152 ALIRIIGFDNNRQVQCISFIAYKPPSFTD 180
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEGY 181
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEGY 181
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEGY 181
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP G+ Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKPEGY 181
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 47.4 bits (111), Expect = 1e-05 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQCVSFIA KP GF Sbjct: 147 AWIRIIGFDNVRQVQCVSFIASKPTGF 173
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 47.0 bits (110), Expect = 1e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD RQVQC+SFIA+KP G+ Sbjct: 154 AFIRIIGFDNNRQVQCISFIAYKPTGY 180
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP GF Sbjct: 152 AWIRIIGFDNVRQVQCISFIASKPDGF 178
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP GF Sbjct: 152 AWIRIIGFDNVRQVQCISFIASKPEGF 178
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP GF Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDGF 173
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 47.0 bits (110), Expect = 1e-05 Identities = 19/28 (67%), Positives = 25/28 (89%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFE 111 A++RIIGFD +RQVQCVSFIA+KP ++ Sbjct: 158 AFIRIIGFDNVRQVQCVSFIAYKPASYD 185
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP GF Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDGF 173
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP GF Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDGF 173
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP GF Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPGGF 173
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 46.6 bits (109), Expect = 2e-05 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFE 111 A++RIIGFD +RQVQC+SFIA+KP ++ Sbjct: 154 AFIRIIGFDNVRQVQCISFIAYKPASYD 181
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA+KP F Sbjct: 154 AHIRIIGFDNVRQVQCISFIAYKPEAF 180
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 46.6 bits (109), Expect = 2e-05 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFE 111 A++RIIGFD +RQVQC+SFIA+KP ++ Sbjct: 155 AFIRIIGFDNVRQVQCISFIAYKPASYD 182
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPG 117 A++RIIGFD RQVQCVSFIA+KP G Sbjct: 156 AFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 46.2 bits (108), Expect = 2e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQCVSFIA+KP + Sbjct: 155 AFIRIIGFDNVRQVQCVSFIAYKPASY 181
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 46.2 bits (108), Expect = 2e-05 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPG 117 A++R+IGFD +RQVQC+SFI KPPG Sbjct: 154 AFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 46.2 bits (108), Expect = 2e-05 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQCVSFIA+KP + Sbjct: 154 AFIRIIGFDNVRQVQCVSFIAYKPASY 180
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFE 111 A+ RIIGFD +RQVQC+SFIA+KP ++ Sbjct: 152 AFTRIIGFDNVRQVQCISFIAYKPASYD 179
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 +++RIIGFD RQVQC+SFIA+KPP Sbjct: 156 SHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 45.4 bits (106), Expect = 4e-05 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPG 117 A++RIIGFD RQVQ +SFIA+KPPG Sbjct: 156 AFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGFE 111 Y RIIGFD +RQVQC+SF+A+KP G E Sbjct: 157 YGRIIGFDNVRQVQCISFLAYKPKGAE 183
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPG 117 A+ R+IGFD ++Q QCVSFIA+KPPG Sbjct: 143 AFHRVIGFDNIKQTQCVSFIAYKPPG 168
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 44.7 bits (104), Expect = 7e-05 Identities = 18/24 (75%), Positives = 23/24 (95%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++RIIGFD +RQVQC+SFIA+KP Sbjct: 154 AWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 44.7 bits (104), Expect = 7e-05 Identities = 17/24 (70%), Positives = 23/24 (95%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQC+SFIA+KP Sbjct: 156 AFIRVIGFDNVRQVQCISFIAYKP 179
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 44.7 bits (104), Expect = 7e-05 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++RIIGFD RQVQCVSFIA+KP Sbjct: 157 AFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A+VRIIGFD RQVQC+SFIA+KP Sbjct: 153 AHVRIIGFDNKRQVQCISFIAYKP 176
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+SFIA KP F Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKPDXF 173
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/27 (62%), Positives = 23/27 (85%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VR IGF+ R+VQC+SFIA+KP G+ Sbjct: 97 AFVRFIGFNDKREVQCISFIAYKPAGY 123
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 +VRIIGFD RQVQC+SFIA+KP Sbjct: 150 FVRIIGFDNKRQVQCISFIAYKP 172
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 +VRIIGFD RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 +VRIIGFD RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 +VRIIGFD RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 +VRIIGFD RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 +VRIIGFD RQVQC+SFIA+KP Sbjct: 154 FVRIIGFDNKRQVQCISFIAYKP 176
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 42.7 bits (99), Expect = 3e-04 Identities = 17/27 (62%), Positives = 23/27 (85%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A++RIIGFD +RQVQC+ FIA +P G+ Sbjct: 152 AWIRIIGFDNVRQVQCIMFIASRPDGY 178
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 42.7 bits (99), Expect = 3e-04 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGFEEXG 102 A+VRIIGFD +RQVQ +SFIA+ PG EE G Sbjct: 141 AFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA P + Sbjct: 154 AFVRIIGFDNVRQVQCISFIAHTPESY 180
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VRIIGFD +RQVQC+SFIA P + Sbjct: 154 AFVRIIGFDNVRQVQCISFIAHTPESY 180
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 41.6 bits (96), Expect = 6e-04 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQC+SFI KP Sbjct: 163 AFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 41.6 bits (96), Expect = 6e-04 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQC+SFI KP Sbjct: 147 AFIRVIGFDNVRQVQCISFIVHKP 170
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 41.2 bits (95), Expect = 8e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQCVSFI KP Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 41.2 bits (95), Expect = 8e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQCVSFI KP Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 41.2 bits (95), Expect = 8e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQCVSFI KP Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 40.8 bits (94), Expect = 0.001 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 +++RIIGFD +RQVQC+SFIA P + Sbjct: 154 SFIRIIGFDNVRQVQCISFIAHTPKNY 180
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++RIIGFD +RQVQC+SFIA P Sbjct: 152 AFIRIIGFDNVRQVQCISFIASTP 175
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 A++R+IGFD +RQVQCVSFI +P Sbjct: 155 AFIRVIGFDNVRQVQCVSFIVERP 178
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 185 RIIGFDXMRQVQCVSFIAFKPPG 117 RIIGFD RQVQC+SF+ +KP G Sbjct: 155 RIIGFDNTRQVQCISFLTYKPEG 177
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPPGF 114 A+VR+IGF+ +RQVQC+SFIA P + Sbjct: 110 AFVRVIGFNNVRQVQCISFIAHTPESY 136
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 36.2 bits (82), Expect = 0.024 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R++GFD ++Q Q VSFI +KP Sbjct: 84 YIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 35.8 bits (81), Expect = 0.032 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R +GFD RQVQC SFI +P Sbjct: 156 YIRCLGFDNTRQVQCASFIVHQP 178
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 35.0 bits (79), Expect = 0.054 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 AY+R++ FD +RQVQ + F+ +KP Sbjct: 82 AYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 35.0 bits (79), Expect = 0.054 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R+IGFD ++Q Q VSFI KP Sbjct: 84 YIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 34.7 bits (78), Expect = 0.071 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQALAA 87 YVR+ FD ++QVQ +SF+ +P G +AA Sbjct: 1100 YVRLAAFDSVKQVQVISFVVQRPSGSSSSSWGMAA 1134 Score = 34.7 bits (78), Expect = 0.071 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQALAA 87 YVR+ FD ++QVQ +SF+ +P G +AA Sbjct: 525 YVRLAAFDSVKQVQVISFVVQRPSGSSSSSWGMAA 559 Score = 34.7 bits (78), Expect = 0.071 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQALAA 87 YVR+ FD ++QVQ +SF+ +P G +AA Sbjct: 238 YVRLAAFDSVKQVQVISFVVQRPSGSSSSSWGMAA 272 Score = 32.3 bits (72), Expect = 0.35 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPG 117 YVR+ FD ++QVQ +SF+ +P G Sbjct: 812 YVRLAAFDSVKQVQVISFVVQRPSG 836 Score = 32.3 bits (72), Expect = 0.35 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPG 117 YVR+ FD ++QVQ +SF+ +P G Sbjct: 669 YVRLAAFDSVKQVQVISFVVQRPSG 693 Score = 32.3 bits (72), Expect = 0.35 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPG 117 YVR+ FD ++QVQ +SF+ +P G Sbjct: 382 YVRLAAFDSVKQVQVISFVVQRPSG 406 Score = 30.4 bits (67), Expect = 1.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 YVR+ FD ++QVQ +SF+ +P Sbjct: 1244 YVRLAAFDSVKQVQVISFVVQRP 1266 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKPPGFEEXGQALAA 87 YVR+ FD ++QVQ +SF+ +P G +AA Sbjct: 957 YVRL-AFDSVKQVQVISFVVQRPSGSSSSSWGMAA 990
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 34.7 bits (78), Expect = 0.071 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R++GFD ++Q Q VSFI KP Sbjct: 84 YIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 182 IIGFDXMRQVQCVSFIAFKPPGFE 111 I+GFD +RQ Q ++FIA+KP G E Sbjct: 145 ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 33.5 bits (75), Expect = 0.16 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R++GFD ++Q Q +SFI KP Sbjct: 84 YIRVVGFDNIKQCQILSFIVHKP 106
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 32.3 bits (72), Expect = 0.35 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R++ FD ++QVQC+ F+ +P Sbjct: 132 YIRLVAFDNVKQVQCMGFLVQRP 154
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 32.0 bits (71), Expect = 0.46 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 191 YVRIIGFDXMRQVQCVSFIAFKP 123 Y+R+ GFD ++Q Q VSFI +P Sbjct: 85 YIRVAGFDNIKQCQTVSFIVHRP 107
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 32.0 bits (71), Expect = 0.46 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 146 AYIRLVCFDANRQVQICGFLVHRPP 170
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 146 AYIRLVCFDANRQVQISGFLVHRPP 170
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 146 AYIRLVCFDANRQVQISGFLVHRPP 170
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 136 AYIRLVCFDANRQVQISGFLVHRPP 160
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 49 AYIRLVCFDANRQVQISGFLVHRPP 73
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 145 AYIRLVCFDANRQVQISGFLVHRPP 169
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 147 AYIRLVCFDANRQVQISGFLVHRPP 171
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 145 AYIRLVCFDANRQVQISGFLVHRPP 169
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 145 AYIRLVCFDANRQVQISGFLVHRPP 169
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 145 AYIRLVCFDANRQVQISGFLVHRPP 169
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 145 AYIRLVCFDANRQVQISGFLVHRPP 169
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKPP 120 AY+R++ FD RQVQ F+ +PP Sbjct: 89 AYIRLVCFDANRQVQISGFLVHRPP 113
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 AYVR++ FD +QVQ + F+ +P Sbjct: 148 AYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 AYVR++ FD +QVQ + F+ +P Sbjct: 148 AYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 194 AYVRIIGFDXMRQVQCVSFIAFKP 123 AY+R++ FD RQVQ F+ +P Sbjct: 138 AYIRLVCFDANRQVQISGFLVHRP 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,741,276 Number of Sequences: 219361 Number of extensions: 217997 Number of successful extensions: 460 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)