| Clone Name | rbaal10h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CB024_HUMAN (Q9BV87) Protein C2orf24 | 31 | 1.1 | 2 | PKN3_MOUSE (Q8K045) Serine/threonine-protein kinase N3 (EC 2.7.1... | 29 | 4.1 | 3 | CB024_PONPY (Q5R4U5) Protein C2orf24 homolog | 29 | 4.1 | 4 | GRISA_PODAN (Q92258) GRISEA protein (MAC1 homolog) | 28 | 7.0 |
|---|
>CB024_HUMAN (Q9BV87) Protein C2orf24| Length = 410 Score = 30.8 bits (68), Expect = 1.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 13 SPXPGLEDQAXATGCRMRPAAMPLPACLPSLXCIRSLMAVSM 138 +P PG D + C + P +P CLPS + S + SM Sbjct: 262 TPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLEGSM 303
>PKN3_MOUSE (Q8K045) Serine/threonine-protein kinase N3 (EC 2.7.11.13) (Protein| kinase PKN-beta) (Protein-kinase C-related kinase 3) Length = 878 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +1 Query: 7 KPSPXPG---LEDQAXATGCRMRPAAMPLPACLPSLXCI 114 KP P P L++ A T C RP P PA +P+L + Sbjct: 499 KPPPKPPRLYLQEPAPGTPCTKRPHMDPRPAVVPALAAL 537
>CB024_PONPY (Q5R4U5) Protein C2orf24 homolog| Length = 410 Score = 28.9 bits (63), Expect = 4.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 13 SPXPGLEDQAXATGCRMRPAAMPLPACLPSLXCIRSLM 126 +P PG D + C + P +P CLPS + S + Sbjct: 262 TPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCL 299
>GRISA_PODAN (Q92258) GRISEA protein (MAC1 homolog)| Length = 597 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 57 PHETGRYAFAGLPPQPXLYPVLDGS 131 PH G AF G PP P PVL+ S Sbjct: 238 PHPQGMQAFNGPPPPPPSNPVLEPS 262 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,989,707 Number of Sequences: 219361 Number of extensions: 307451 Number of successful extensions: 1096 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1096 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)